You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNAD-specific glutamate dehydrogenase
Synonyms
  • NAD-GDH
Gene NameGDH2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionL-glutamate + H(2)O + NAD(+) = 2-oxoglutarate + NH(3) + NADH
Cellular LocationNot Available
SMPDB Pathways
Glutamate MetabolismPW002376 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Arginine and proline metabolismec00330 Map00330
Nitrogen metabolismec00910 Map00910
SMPDB Reactions
L-Glutamic acid + water + NADOxoglutaric acid + Ammonium + NADH + hydron
L-Glutamic acid + water + NADAmmonium + NADH + hydron + Oxoglutaric acid
KEGG Reactions
NAD + L-Glutamic acid + waterNADH + Oxoglutaric acid + hydron + Ammonium
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00153Oxoglutaric acidShow
YMDB00271L-Glutamic acidShow
YMDB00412NAD(+)Show
YMDB00423AmmoniumShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
binding
oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
oxidoreductase activity, acting on the CH-NH2 group of donors
oxidoreductase activity
glutamate dehydrogenase activity
catalytic activity
Process
oxidation reduction
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
dicarboxylic acid metabolic process
2-oxoglutarate metabolic process
metabolic process
glutamate catabolic process to 2-oxoglutarate
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL215C
Gene Sequence>3279 bp ATGCTTTTTGATAACAAAAATCGCGGTGCTTTAAACTCACTGAACACACCAGATATTGCT TCTTTATCAATATCATCCATGTCGGACTATCACGTGTTTGATTTTCCCGGTAAGGACCTG CAGAGAGAGGAAGTGATAGATTTGCTAGATCAGCAAGGGTTTATTCCCGACGATTTGATC GAACAAGAAGTAGATTGGTTTTATAACTCATTGGGTATTGACGATTTGTTCTTCTCGAGA GAATCTCCCCAATTAATCTCGAATATCATACATTCTTTGTATGCTTCAAAGCTAGATTTC TTTGCGAAGTCCAAATTCAACGGAATTCAGCCAAGGCTATTCAGCATTAAAAACAAAATT ATAACTAATGATAATCATGCCATCTTTATGGAATCTAATACTGGTGTCAGCATAAGCGAT TCTCAGCAAAAAAACTTTAAATTTGCTAGTGACGCCGTCGGAAACGATACTTTGGAGCAT GGTAAGGATACCATCAAAAAAAATAGGATTGAAATGGATGATTCTTGTCCACCTTATGAA TTAGATTCCGAAATTGATGACCTTTTCCTGGATAACAAGTCTCAAAAAAACTGCAGATTA GTTTCTTTTTGGGCTCCAGAAAGCGAATTAAAGCTAACTTTTGTTTATGAGAGTGTTTAC CCTAATGATGATCCAGCCGGCGTAGATATTTCCTCTCAGGATTTGCTGAAAGGTGATATT GAATCGATTAGTGATAAGACCATGTACAAAGTTTCGTCGAACGAAAATAAAAAACTATAC GGTCTCTTACTTAAGTTGGTTAAAGAAAGAGAAGGTCCTGTCATTAAGACTACTCGCTCC GTAGAAAATAAGGATGAAATTAGGTTATTAGTCGCTTACAAGCGATTCACCACTAAGCGT TATTACTCTGCTTTGAACTCTTTGTTCCACTATTACAAGTTGAAACCTTCTAAGTTCTAT TTAGAGTCGTTTAATGTTAAGGATGATGACATCATTATCTTTTCCGTTTATTTGAACGAG AACCAGCAATTGGAAGATGTTCTACTTCACGATGTGGAGGCAGCATTGAAACAGGTTGAA AGAGAAGCTTCATTGCTATACGCTATCCCAAACAATTCTTTCCATGAGGTTTACCAGAGA CGTCAATTCTCGCCCAAAGAAGCTATATATGCTCATATTGGTGCTATATTCATTAACCAT TTTGTTAATCGTTTAGGCTCTGATTATCAAAACCTTTTATCTCAAATCACCATTAAGCGT AATGATACTACTCTTTTGGAGATTGTAGAAAACCTAAAAAGAAAGTTAAGAAATGAAACC TTAACTCAGCAAACTATTATCAACATCATGTCGAAGCATTACACTATAATTTCCAAGTTG TATAAAAATTTTGCTCAAATTCACTATTATCATAATAGTACTAAAGATATGGAGAAGACA TTATCTTTTCAAAGACTGGAAAAAGTGGAGCCTTTTAAGAATGACCAAGAGTTCGAAGCT TACTTGAATAAATTCATTCCAAATGATTCACCTGATTTGTTGATCCTGAAAACACTGAAC ATCTTCAACAAGTCTATTTTGAAGACAAATTTCTTTATTACAAGAAAAGTAGCAATATCA TTCAGATTAGATCCTTCCCTGGTGATGACAAAATTCGAATATCCAGAGACACCCTATGGT ATATTTTTTGTCGTTGGTAATACTTTCAAAGGGTTCCATATCAGGTTCAGAGATATCGCA AGGGGCGGTATTCGTATAGTCTGTTCCAGGAATCAGGATATTTATGATTTGAATTCCAAG AACGTTATTGATGAGAACTATCAATTGGCCTCTACTCAGCAACGTAAAAATAAGGATATT CCAGAGGGTGGCTCTAAAGGTGTCATCTTATTGAACCCAGGATTGGTAGAACATGACCAG ACATTTGTCGCCTTTTCCCAATATGTGGATGCAATGATTGACATTCTAATCAACGATCCA TTAAAGGAAAACTATGTCAACCTTTTACCAAAGGAGGAAATATTATTTTTTGGCCCAGAT GAAGGAACTGCTGGTTTCGTGGATTGGGCAACTAACCATGCTCGTGTGAGGAACTGCCCA TGGTGGAAATCATTTTTGACTGGAAAATCCCCATCTTTGGGTGGTATTCCCCATGACGAA TATGGTATGACTTCTCTGGGTGTTCGTGCTTATGTTAATAAAATTTACGAAACTTTAAAC TTGACAAATTCTACTGTTTACAAATTCCAAACTGGTGGTCCGGATGGTGATTTGGGATCC AATGAAATTCTTTTATCTTCGCCAAACGAATGTTATTTGGCAATTCTGGACGGTTCAGGT GTCCTGTGTGATCCTAAAGGTTTAGATAAAGATGAATTATGCCGCTTGGCACATGAAAGG AAAATGATTTCCGATTTCGACACTTCCAAATTATCAAACAACGGATTTTTTGTTTCTGTG GATGCAATGGATATCATGCTACCAAATGGTACAATTGTAGCTAACGGCACAACCTTCAGA AACACCTTTCATACTCAAATTTTCAAATTTGTGGATCATGTCGACATTTTTGTTCCATGC GGTGGTAGACCAAACTCAATTACTCTAAATAATCTACATTATTTTGTTGACGAAAAGACT GGGAAATGTAAAATTCCATATATTGTGGAGGGTGCCAATCTATTTATAACGCAACCTGCT AAAAATGCTTTGGAGGAACATGGCTGTATTCTGTTCAAAGATGCTTCTGCAAACAAAGGT GGTGTCACATCTTCATCAATGGAAGTGTTGGCCTCACTAGCGCTTAACGATAACGACTTC GTGCACAAATTTATTGGAGATGTTAGTGGTGAGAGGTCTGCGTTGTACAAGTCGTACGTT GTAGAAGTGCAGTCAAGAATTCAGAAAAATGCTGAATTAGAGTTTGGTCAGTTATGGAAT TTGAATCAACTAAATGGAACCCACATTTCAGAAATTTCAAACCAATTGTCCTTCACTATA AACAAATTGAACGACGATCTAGTTGCTTCTCAAGAGTTGTGGCTCAATGATCTAAAATTA AGAAACTACCTATTGTTGGATAAAATAATTCCAAAAATTCTGATTGATGTTGCTGGGCCT CAGTCCGTATTGGAAAACATTCCAGAGAGCTATTTGAAAGTTCTTCTGTCGAGTTACTTA TCAAGCACTTTTGTTTACCAGAACGGTATCGATGTTAACATTGGAAAATTCTTGGAATTT ATTGGTGGGTTAAAAAGAGAAGCGGAGGCAAGTGCTTGA
Protein Properties
Pfam Domain Function
Protein Residues1092
Protein Molecular Weight124331.0
Protein Theoretical pI5.46
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NAD-specific glutamate dehydrogenase MLFDNKNRGALNSLNTPDIASLSISSMSDYHVFDFPGKDLQREEVIDLLDQQGFIPDDLI EQEVDWFYNSLGIDDLFFSRESPQLISNIIHSLYASKLDFFAKSKFNGIQPRLFSIKNKI ITNDNHAIFMESNTGVSISDSQQKNFKFASDAVGNDTLEHGKDTIKKNRIEMDDSCPPYE LDSEIDDLFLDNKSQKNCRLVSFWAPESELKLTFVYESVYPNDDPAGVDISSQDLLKGDI ESISDKTMYKVSSNENKKLYGLLLKLVKEREGPVIKTTRSVENKDEIRLLVAYKRFTTKR YYSALNSLFHYYKLKPSKFYLESFNVKDDDIIIFSVYLNENQQLEDVLLHDVEAALKQVE REASLLYAIPNNSFHEVYQRRQFSPKEAIYAHIGAIFINHFVNRLGSDYQNLLSQITIKR NDTTLLEIVENLKRKLRNETLTQQTIINIMSKHYTIISKLYKNFAQIHYYHNSTKDMEKT LSFQRLEKVEPFKNDQEFEAYLNKFIPNDSPDLLILKTLNIFNKSILKTNFFITRKVAIS FRLDPSLVMTKFEYPETPYGIFFVVGNTFKGFHIRFRDIARGGIRIVCSRNQDIYDLNSK NVIDENYQLASTQQRKNKDIPEGGSKGVILLNPGLVEHDQTFVAFSQYVDAMIDILINDP LKENYVNLLPKEEILFFGPDEGTAGFVDWATNHARVRNCPWWKSFLTGKSPSLGGIPHDE YGMTSLGVRAYVNKIYETLNLTNSTVYKFQTGGPDGDLGSNEILLSSPNECYLAILDGSG VLCDPKGLDKDELCRLAHERKMISDFDTSKLSNNGFFVSVDAMDIMLPNGTIVANGTTFR NTFHTQIFKFVDHVDIFVPCGGRPNSITLNNLHYFVDEKTGKCKIPYIVEGANLFITQPA KNALEEHGCILFKDASANKGGVTSSSMEVLASLALNDNDFVHKFIGDVSGERSALYKSYV VEVQSRIQKNAELEFGQLWNLNQLNGTHISEISNQLSFTINKLNDDLVASQELWLNDLKL RNYLLLDKIIPKILIDVAGPQSVLENIPESYLKVLLSSYLSSTFVYQNGIDVNIGKFLEF IGGLKREAEASA
References
External Links
ResourceLink
Saccharomyces Genome Database GDH2
Uniprot IDP33327
Uniprot NameDHE2_YEAST
GenBank Gene IDX72015
Genebank Protein ID396751
General Reference
  • Boles, E., Lehnert, W., Zimmermann, F. K. (1993). "The role of the NAD-dependent glutamate dehydrogenase in restoring growth on glucose of a Saccharomyces cerevisiae phosphoglucose isomerase mutant." Eur J Biochem 217:469-477.7901008
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Miller, S. M., Magasanik, B. (1991). "Role of the complex upstream region of the GDH2 gene in nitrogen regulation of the NAD-linked glutamate dehydrogenase in Saccharomyces cerevisiae." Mol Cell Biol 11:6229-6247.1682801
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956