You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNAD-specific glutamate dehydrogenase
Synonyms
  • NAD-GDH
Gene NameGDH2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionL-glutamate + H(2)O + NAD(+) = 2-oxoglutarate + NH(3) + NADH
Cellular LocationNot Available
SMPDB Pathways
Glutamate MetabolismPW002376 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Arginine and proline metabolismec00330 Map00330
Nitrogen metabolismec00910 Map00910
SMPDB Reactions
L-Glutamic acid + water + NADOxoglutaric acid + Ammonium + NADH + hydron
L-Glutamic acid + water + NADAmmonium + NADH + hydron + Oxoglutaric acid
KEGG Reactions
NAD + L-Glutamic acid + waterNADH + Oxoglutaric acid + hydron + Ammonium
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00153Oxoglutaric acidShow
YMDB00271L-Glutamic acidShow
YMDB00412NAD(+)Show
YMDB00423AmmoniumShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
glutamate dehydrogenase activity
binding
oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
oxidoreductase activity, acting on the CH-NH2 group of donors
oxidoreductase activity
catalytic activity
Process
carboxylic acid metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
dicarboxylic acid metabolic process
cellular amino acid metabolic process
2-oxoglutarate metabolic process
glutamate catabolic process to 2-oxoglutarate
oxidation reduction
organic acid metabolic process
metabolic process
oxoacid metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL215C
Gene Sequence>3279 bp ATGCTTTTTGATAACAAAAATCGCGGTGCTTTAAACTCACTGAACACACCAGATATTGCT TCTTTATCAATATCATCCATGTCGGACTATCACGTGTTTGATTTTCCCGGTAAGGACCTG CAGAGAGAGGAAGTGATAGATTTGCTAGATCAGCAAGGGTTTATTCCCGACGATTTGATC GAACAAGAAGTAGATTGGTTTTATAACTCATTGGGTATTGACGATTTGTTCTTCTCGAGA GAATCTCCCCAATTAATCTCGAATATCATACATTCTTTGTATGCTTCAAAGCTAGATTTC TTTGCGAAGTCCAAATTCAACGGAATTCAGCCAAGGCTATTCAGCATTAAAAACAAAATT ATAACTAATGATAATCATGCCATCTTTATGGAATCTAATACTGGTGTCAGCATAAGCGAT TCTCAGCAAAAAAACTTTAAATTTGCTAGTGACGCCGTCGGAAACGATACTTTGGAGCAT GGTAAGGATACCATCAAAAAAAATAGGATTGAAATGGATGATTCTTGTCCACCTTATGAA TTAGATTCCGAAATTGATGACCTTTTCCTGGATAACAAGTCTCAAAAAAACTGCAGATTA GTTTCTTTTTGGGCTCCAGAAAGCGAATTAAAGCTAACTTTTGTTTATGAGAGTGTTTAC CCTAATGATGATCCAGCCGGCGTAGATATTTCCTCTCAGGATTTGCTGAAAGGTGATATT GAATCGATTAGTGATAAGACCATGTACAAAGTTTCGTCGAACGAAAATAAAAAACTATAC GGTCTCTTACTTAAGTTGGTTAAAGAAAGAGAAGGTCCTGTCATTAAGACTACTCGCTCC GTAGAAAATAAGGATGAAATTAGGTTATTAGTCGCTTACAAGCGATTCACCACTAAGCGT TATTACTCTGCTTTGAACTCTTTGTTCCACTATTACAAGTTGAAACCTTCTAAGTTCTAT TTAGAGTCGTTTAATGTTAAGGATGATGACATCATTATCTTTTCCGTTTATTTGAACGAG AACCAGCAATTGGAAGATGTTCTACTTCACGATGTGGAGGCAGCATTGAAACAGGTTGAA AGAGAAGCTTCATTGCTATACGCTATCCCAAACAATTCTTTCCATGAGGTTTACCAGAGA CGTCAATTCTCGCCCAAAGAAGCTATATATGCTCATATTGGTGCTATATTCATTAACCAT TTTGTTAATCGTTTAGGCTCTGATTATCAAAACCTTTTATCTCAAATCACCATTAAGCGT AATGATACTACTCTTTTGGAGATTGTAGAAAACCTAAAAAGAAAGTTAAGAAATGAAACC TTAACTCAGCAAACTATTATCAACATCATGTCGAAGCATTACACTATAATTTCCAAGTTG TATAAAAATTTTGCTCAAATTCACTATTATCATAATAGTACTAAAGATATGGAGAAGACA TTATCTTTTCAAAGACTGGAAAAAGTGGAGCCTTTTAAGAATGACCAAGAGTTCGAAGCT TACTTGAATAAATTCATTCCAAATGATTCACCTGATTTGTTGATCCTGAAAACACTGAAC ATCTTCAACAAGTCTATTTTGAAGACAAATTTCTTTATTACAAGAAAAGTAGCAATATCA TTCAGATTAGATCCTTCCCTGGTGATGACAAAATTCGAATATCCAGAGACACCCTATGGT ATATTTTTTGTCGTTGGTAATACTTTCAAAGGGTTCCATATCAGGTTCAGAGATATCGCA AGGGGCGGTATTCGTATAGTCTGTTCCAGGAATCAGGATATTTATGATTTGAATTCCAAG AACGTTATTGATGAGAACTATCAATTGGCCTCTACTCAGCAACGTAAAAATAAGGATATT CCAGAGGGTGGCTCTAAAGGTGTCATCTTATTGAACCCAGGATTGGTAGAACATGACCAG ACATTTGTCGCCTTTTCCCAATATGTGGATGCAATGATTGACATTCTAATCAACGATCCA TTAAAGGAAAACTATGTCAACCTTTTACCAAAGGAGGAAATATTATTTTTTGGCCCAGAT GAAGGAACTGCTGGTTTCGTGGATTGGGCAACTAACCATGCTCGTGTGAGGAACTGCCCA TGGTGGAAATCATTTTTGACTGGAAAATCCCCATCTTTGGGTGGTATTCCCCATGACGAA TATGGTATGACTTCTCTGGGTGTTCGTGCTTATGTTAATAAAATTTACGAAACTTTAAAC TTGACAAATTCTACTGTTTACAAATTCCAAACTGGTGGTCCGGATGGTGATTTGGGATCC AATGAAATTCTTTTATCTTCGCCAAACGAATGTTATTTGGCAATTCTGGACGGTTCAGGT GTCCTGTGTGATCCTAAAGGTTTAGATAAAGATGAATTATGCCGCTTGGCACATGAAAGG AAAATGATTTCCGATTTCGACACTTCCAAATTATCAAACAACGGATTTTTTGTTTCTGTG GATGCAATGGATATCATGCTACCAAATGGTACAATTGTAGCTAACGGCACAACCTTCAGA AACACCTTTCATACTCAAATTTTCAAATTTGTGGATCATGTCGACATTTTTGTTCCATGC GGTGGTAGACCAAACTCAATTACTCTAAATAATCTACATTATTTTGTTGACGAAAAGACT GGGAAATGTAAAATTCCATATATTGTGGAGGGTGCCAATCTATTTATAACGCAACCTGCT AAAAATGCTTTGGAGGAACATGGCTGTATTCTGTTCAAAGATGCTTCTGCAAACAAAGGT GGTGTCACATCTTCATCAATGGAAGTGTTGGCCTCACTAGCGCTTAACGATAACGACTTC GTGCACAAATTTATTGGAGATGTTAGTGGTGAGAGGTCTGCGTTGTACAAGTCGTACGTT GTAGAAGTGCAGTCAAGAATTCAGAAAAATGCTGAATTAGAGTTTGGTCAGTTATGGAAT TTGAATCAACTAAATGGAACCCACATTTCAGAAATTTCAAACCAATTGTCCTTCACTATA AACAAATTGAACGACGATCTAGTTGCTTCTCAAGAGTTGTGGCTCAATGATCTAAAATTA AGAAACTACCTATTGTTGGATAAAATAATTCCAAAAATTCTGATTGATGTTGCTGGGCCT CAGTCCGTATTGGAAAACATTCCAGAGAGCTATTTGAAAGTTCTTCTGTCGAGTTACTTA TCAAGCACTTTTGTTTACCAGAACGGTATCGATGTTAACATTGGAAAATTCTTGGAATTT ATTGGTGGGTTAAAAAGAGAAGCGGAGGCAAGTGCTTGA
Protein Properties
Pfam Domain Function
Protein Residues1092
Protein Molecular Weight124331.0
Protein Theoretical pI5.46
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NAD-specific glutamate dehydrogenase MLFDNKNRGALNSLNTPDIASLSISSMSDYHVFDFPGKDLQREEVIDLLDQQGFIPDDLI EQEVDWFYNSLGIDDLFFSRESPQLISNIIHSLYASKLDFFAKSKFNGIQPRLFSIKNKI ITNDNHAIFMESNTGVSISDSQQKNFKFASDAVGNDTLEHGKDTIKKNRIEMDDSCPPYE LDSEIDDLFLDNKSQKNCRLVSFWAPESELKLTFVYESVYPNDDPAGVDISSQDLLKGDI ESISDKTMYKVSSNENKKLYGLLLKLVKEREGPVIKTTRSVENKDEIRLLVAYKRFTTKR YYSALNSLFHYYKLKPSKFYLESFNVKDDDIIIFSVYLNENQQLEDVLLHDVEAALKQVE REASLLYAIPNNSFHEVYQRRQFSPKEAIYAHIGAIFINHFVNRLGSDYQNLLSQITIKR NDTTLLEIVENLKRKLRNETLTQQTIINIMSKHYTIISKLYKNFAQIHYYHNSTKDMEKT LSFQRLEKVEPFKNDQEFEAYLNKFIPNDSPDLLILKTLNIFNKSILKTNFFITRKVAIS FRLDPSLVMTKFEYPETPYGIFFVVGNTFKGFHIRFRDIARGGIRIVCSRNQDIYDLNSK NVIDENYQLASTQQRKNKDIPEGGSKGVILLNPGLVEHDQTFVAFSQYVDAMIDILINDP LKENYVNLLPKEEILFFGPDEGTAGFVDWATNHARVRNCPWWKSFLTGKSPSLGGIPHDE YGMTSLGVRAYVNKIYETLNLTNSTVYKFQTGGPDGDLGSNEILLSSPNECYLAILDGSG VLCDPKGLDKDELCRLAHERKMISDFDTSKLSNNGFFVSVDAMDIMLPNGTIVANGTTFR NTFHTQIFKFVDHVDIFVPCGGRPNSITLNNLHYFVDEKTGKCKIPYIVEGANLFITQPA KNALEEHGCILFKDASANKGGVTSSSMEVLASLALNDNDFVHKFIGDVSGERSALYKSYV VEVQSRIQKNAELEFGQLWNLNQLNGTHISEISNQLSFTINKLNDDLVASQELWLNDLKL RNYLLLDKIIPKILIDVAGPQSVLENIPESYLKVLLSSYLSSTFVYQNGIDVNIGKFLEF IGGLKREAEASA
References
External Links
ResourceLink
Saccharomyces Genome Database GDH2
Uniprot IDP33327
Uniprot NameDHE2_YEAST
GenBank Gene IDX72015
Genebank Protein ID396751
General Reference
  • Boles, E., Lehnert, W., Zimmermann, F. K. (1993). "The role of the NAD-dependent glutamate dehydrogenase in restoring growth on glucose of a Saccharomyces cerevisiae phosphoglucose isomerase mutant." Eur J Biochem 217:469-477.7901008
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Miller, S. M., Magasanik, B. (1991). "Role of the complex upstream region of the GDH2 gene in nitrogen regulation of the NAD-linked glutamate dehydrogenase in Saccharomyces cerevisiae." Mol Cell Biol 11:6229-6247.1682801
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956