You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameEnolase-phosphatase E1
Synonyms
  • 2,3-diketo-5-methylthio-1-phosphopentane phosphatase
  • Unknown transcript 4 protein
Gene NameUTR4
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionBifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene)
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
SMPDB Reactions
water + 5-(methylsulfanyl)-2,3-dioxopentyl phosphate hydron + phosphate + 1,2-Dihydroxy-3-keto-5-methylthiopentene
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB000245-(methylsulfanyl)-2,3-dioxopentyl phosphateShow
YMDB00073Glycerol 3-phosphateShow
YMDB001851,2-Dihydroxy-3-keto-5-methylthiopenteneShow
YMDB00283GlycerolShow
YMDB00385Formic acidShow
YMDB004214-Methylthio-2-oxobutanoateShow
YMDB00807glycolic acidShow
YMDB00858Phosphoglycolic acidShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00989glycerol 1-phosphateShow
YMDB00994glycerol 2-phosphateShow
GO Classification
Component
Not Available
Function
cation binding
metal ion binding
hydrolase activity
catalytic activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
phosphoglycolate phosphatase activity
acireductone synthase activity
binding
ion binding
Process
L-methionine salvage from methylthioadenosine
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular amino acid biosynthetic process
amino acid salvage
Gene Properties
Chromosome Locationchromosome 5
LocusYEL038W
Gene Sequence>726 bp ATGGTCATTGGGCAAAAGGTCCTGCTAGCTCGTATACCAAAAATGGGAGACAATTACTCG ACTTACTTGCTTGATATTGAAGGGACAGTGTGCCCGATCTCGTTCGTGAAGGAGACTTTA TTCCCTTATTTCACGAATAAAGTGCCGCAATTGGTTCAACAGGATACAAGGGACTCCCCG GTTTCCAACATTCTGTCGCAGTTTCACATCGACAATAAGGAGCAGTTGCAGGCGCATATT TTGGAGTTGGTGGCCAAGGATGTGAAGGATCCAATCTTGAAACAGTTGCAAGGCTACGTC TGGGCTCACGGATACGAATCTGGGCAGATTAAGGCGCCCGTTTATGCAGATGCTATTGAC TTTATCAAGAGGAAGAAGCGTGTGTTTATCTACTCTAGTGGATCTGTAAAGGCACAGAAA TTGCTGTTCGGGTATGTTCAGGATCCCAACGCGCCTGCGCATGATTCGTTGGATTTGAAT TCTTATATAGATGGTTATTTCGACATCAACACTTCTGGAAAGAAAACCGAAACACAGTCT TACGCCAACATCTTGCGGGATATCGGTGCGAAGGCTAGCGAGGTACTGTTCTTGAGCGAT AATCCATTGGAATTGGACGCAGCGGCCGGCGTTGGAATAGCTACTGGGTTAGCTTCCCGA CCTGGTAATGCACCTGTCCCCGATGGGCAAAAGTACCAGGTATACAAGAATTTTGAAACT CTTTAA
Protein Properties
Pfam Domain Function
Protein Residues227
Protein Molecular Weight25187.19922
Protein Theoretical pI5.3
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Enolase-phosphatase E1 MGDNYSTYLLDIEGTVCPISFVKETLFPYFTNKVPQLVQQDTRDSPVSNILSQFHIDNKE QLQAHILELVAKDVKDPILKQLQGYVWAHGYESGQIKAPVYADAIDFIKRKKRVFIYSSG SVKAQKLLFGYVQDPNAPAHDSLDLNSYIDGYFDINTSGKKTETQSYANILRDIGAKASE VLFLSDNPLELDAAAGVGIATGLASRPGNAPVPDGQKYQVYKNFETL
References
External Links
ResourceLink
Saccharomyces Genome Database UTR4
Uniprot IDP32626
Uniprot NameENOPH_YEAST
GenBank Gene IDU18779
Genebank Protein ID603641
General Reference
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Melnick, L., Sherman, F. (1993). "The gene clusters ARC and COR on chromosomes 5 and 10, respectively, of Saccharomyces cerevisiae share a common ancestry." J Mol Biol 233:372-388.8411151
  • Kellis, M., Patterson, N., Endrizzi, M., Birren, B., Lander, E. S. (2003). "Sequencing and comparison of yeast species to identify genes and regulatory elements." Nature 423:241-254.12748633