You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGuanosine-diphosphatase
Synonyms
  • GDPase
Gene NameGDA1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity
Specific FunctionAfter transfer of sugars to endogenous macromolecular acceptors, the enzyme converts nucleoside diphosphates to nucleoside monophosphates which in turn exit the Golgi lumen in a coupled antiporter reaction, allowing entry of additional nucleotide sugar from the cytosol
Cellular LocationGolgi apparatus membrane; Single-pass type II membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
water + Guanosine diphosphateGuanosine monophosphate + phosphate + hydron
Metabolites
YMDB IDNameView
YMDB00257Guanosine diphosphateShow
YMDB00261Guanosine monophosphateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
cell part
membrane
organelle membrane
Golgi membrane
Function
hydrolase activity
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
nucleoside-diphosphatase activity
guanosine-diphosphatase activity
catalytic activity
Process
protein modification process
metabolic process
macromolecule metabolic process
macromolecule modification
Gene Properties
Chromosome Locationchromosome 5
LocusYEL042W
Gene Sequence>1557 bp ATGGCGCCCATCTTTAGAAATTACCGGTTCGCTATCGGTGCTTTTGCCGTTATTATGCTC ATTTTGTTGATTAAAACATCTTCCATCGGTCCACCTTCTATTGCACGTACAGTTACTCCT AATGCTAGTATTCCCAAAACTCCGGAGGACATCTCTATCTTGCCCGTCAATGATGAACCA GGTTACCTTCAAGATTCGAAGACTGAACAAAACTATCCTGAGCTTGCCGATGCTGTGAAG TCACAAACAAGTCAAACATGCAGCGAAGAACATAAGTATGTTATCATGATCGATGCCGGC TCTACCGGTTCCCGAGTACATATATACAAGTTTGACGTCTGTACCTCCCCACCTACATTA CTTGATGAAAAATTCGACATGTTAGAGCCTGGTTTATCTTCTTTCGATACCGATTCCGTT GGTGCCGCTAACTCCCTTGACCCATTACTGAAAGTAGCAATGAACTATGTCCCTATTAAG GCAAGAAGTTGTACTCCCGTTGCGGTGAAAGCTACTGCAGGCCTAAGACTCTTGGGTGAT GCCAAATCTTCAAAAATTTTGAGCGCTGTAAGGGATCATTTGGAGAAGGACTATCCTTTC CCAGTTGTCGAAGGTGATGGTGTTTCCATCATGGGCGGTGATGAAGAAGGTGTCTTCGCC TGGATTACTACAAACTACCTATTAGGTAATATCGGTGCTAATGGCCCCAAGTTACCTACT GCTGCCGTTTTTGACTTAGGCGGAGGGTCTACACAAATTGTTTTTGAGCCTACTTTCCCA ATAAATGAAAAAATGGTCGATGGTGAGCATAAATTTGATTTGAAGTTTGGTGATGAAAAT TACACCTTGTACCAATTTTCTCATCTAGGTTACGGCTTGAAGGAAGGAAGAAATAAAGTT AACTCTGTTCTTGTGGAAAATGCATTAAAAGACGGCAAAATATTGAAGGGTGATAACACT AAGACTCATCAATTGTCATCTCCATGCCTACCGCCTAAAGTTAATGCCACAAATGAAAAG GTTACATTAGAATCCAAGGAAACTTATACCATTGACTTTATAGGGCCGGACGAGCCAAGT GGTGCACAATGTAGATTTCTGACTGATGAAATTTTGAATAAAGATGCTCAGTGCCAGTCT CCACCATGCTCTTTCAATGGGGTTCACCAACCTTCTTTAGTTCGTACATTCAAAGAATCG AACGATATCTATATTTTCTCTTATTTCTACGACAGAACCCGTCCATTGGGTATGCCCTTG TCCTTTACTTTGAATGAATTGAACGATTTGGCAAGAATAGTGTGTAAAGGCGAAGAAACT TGGAATAGTGTCTTCAGTGGCATTGCGGGGTCCCTAGATGAATTGGAAAGTGACTCGCAC TTCTGTTTGGACTTATCTTTTCAAGTGTCCTTATTACATACGGGATATGACATTCCATTA CAAAGAGAATTGAGAACTGGAAAGAAAATTGCCAATAAAGAAATCGGTTGGTGTTTAGGT GCGTCATTACCATTGTTGAAAGCTGATAACTGGAAATGTAAAATTCAATCAGCTTGA
Protein Properties
Pfam Domain Function
Protein Residues518
Protein Molecular Weight56821.0
Protein Theoretical pI4.98
Signalling Regions
  • None
Transmembrane Regions
  • 10-24
Protein Sequence>Guanosine-diphosphatase MAPIFRNYRFAIGAFAVIMLILLIKTSSIGPPSIARTVTPNASIPKTPEDISILPVNDEP GYLQDSKTEQNYPELADAVKSQTSQTCSEEHKYVIMIDAGSTGSRVHIYKFDVCTSPPTL LDEKFDMLEPGLSSFDTDSVGAANSLDPLLKVAMNYVPIKARSCTPVAVKATAGLRLLGD AKSSKILSAVRDHLEKDYPFPVVEGDGVSIMGGDEEGVFAWITTNYLLGNIGANGPKLPT AAVFDLGGGSTQIVFEPTFPINEKMVDGEHKFDLKFGDENYTLYQFSHLGYGLKEGRNKV NSVLVENALKDGKILKGDNTKTHQLSSPCLPPKVNATNEKVTLESKETYTIDFIGPDEPS GAQCRFLTDEILNKDAQCQSPPCSFNGVHQPSLVRTFKESNDIYIFSYFYDRTRPLGMPL SFTLNELNDLARIVCKGEETWNSVFSGIAGSLDELESDSHFCLDLSFQVSLLHTGYDIPL QRELRTGKKIANKEIGWCLGASLPLLKADNWKCKIQSA
References
External Links
ResourceLink
Saccharomyces Genome Database GDA1
Uniprot IDP32621
Uniprot NameGDA1_YEAST
GenBank Gene IDAY723798
Genebank Protein ID51830299
General Reference
  • Abeijon, C., Yanagisawa, K., Mandon, E. C., Hausler, A., Moremen, K., Hirschberg, C. B., Robbins, P. W. (1993). "Guanosine diphosphatase is required for protein and sphingolipid glycosylation in the Golgi lumen of Saccharomyces cerevisiae." J Cell Biol 122:307-323.8391537
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Berninsone, P., Lin, Z. Y., Kempner, E., Hirschberg, C. B. (1995). "Regulation of yeast Golgi glycosylation. Guanosine diphosphatase functions as a homodimer in the membrane." J Biol Chem 270:14564-14567.7540172
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106