You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCystathionine gamma-lyase
Synonyms
  • Gamma-cystathionase
  • Sulfur transfer protein 1
Gene NameCYS3
Enzyme Class
Biological Properties
General FunctionInvolved in pyridoxal phosphate binding
Specific FunctionL-cystathionine + H(2)O = L-cysteine + NH(3) + 2-oxobutanoate
Cellular LocationCytoplasm
SMPDB Pathways
Cysteine MetabolismPW002383 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Glycine, serine and threonine metabolismec00260 Map00260
Nitrogen metabolismec00910 Map00910
Selenocompound metabolismec00450 Map00450
Sulfur metabolismec00920 Map00920
SMPDB Reactions
water + L-CystathionineAmmonium + L-Cysteine + 2-Ketobutyric acid
L-CysteineHydrogen sulfide + hydron + 2-aminoprop-2-enoate
Selenomethionine + watermethylselenol + Ammonia + 2-Ketobutyric acid
Se-Methylselenocysteine + watermethylselenol + Ammonia + Pyruvic acid
KEGG Reactions
L-Cystathionine + waterL-Cysteine + Ammonium + 2-Ketobutyric acid
Metabolites
YMDB IDNameView
YMDB00046L-CysteineShow
YMDB000712-Ketobutyric acidShow
YMDB00091AmmoniaShow
YMDB00175Pyruvic acidShow
YMDB00245L-CystathionineShow
YMDB00423AmmoniumShow
YMDB00653Hydrogen sulfideShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB16175SelenomethionineShow
YMDB16177Se-MethylselenocysteineShow
YMDB162582-aminoprop-2-enoateShow
YMDB16312methylselenolShow
GO Classification
Component
Not Available
Function
binding
cofactor binding
pyridoxal phosphate binding
catalytic activity
Process
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 1
LocusYAL012W
Gene Sequence>1185 bp ATGACTCTACAAGAATCTGATAAATTTGCTACCAAGGCCATTCATGCCGGTGAACATGTG GACGTTCACGGTTCCGTGATCGAACCCATTTCTTTGTCCACCACTTTCAAACAATCTTCT CCAGCTAACCCTATCGGTACTTACGAATACTCCAGATCTCAAAATCCTAACAGAGAGAAC TTGGAAAGAGCAGTTGCCGCTTTAGAGAACGCTCAATACGGGTTGGCTTTCTCCTCTGGT TCTGCCACCACCGCCACAATCTTGCAATCGCTTCCTCAGGGCTCCCATGCGGTCTCTATC GGTGATGTGTACGGTGGTACCCACAGATACTTCACCAAAGTCGCCAACGCTCACGGTGTG GAAACCTCCTTCACTAACGATTTGTTGAACGATCTACCTCAATTGATAAAGGAAAACACC AAATTGGTCTGGATCGAAACCCCAACCAACCCAACTTTGAAGGTCACCGACATCCAAAAG GTGGCAGACCTTATCAAGAAGCACGCTGCCGGCCAAGACGTGATCTTGGTTGTCGACAAC ACCTTCTTGTCCCCATATATCTCCAATCCATTGAACTTCGGTGCAGACATCGTTGTCCAC TCCGCTACAAAGTACATCAACGGTCACTCAGACGTTGTGCTCGGTGTCCTGGCCACTAAT AACAAGCCATTGTACGAGCGTCTGCAGTTCTTACAAAACGCCATTGGTGCTATCCCATCT CCTTTCGATGCTTGGTTGACCCACAGAGGTTTGAAGACTTTGCATCTACGTGTCAGACAA GCTGCCCTCAGCGCCAACAAAATCGCTGAATTCTTGGCAGCAGACAAGGAAAACGTTGTC GCAGTCAACTACCCAGGTTTGAAGACACACCCTAACTACGACGTAGTGTTAAAGCAACAC CGTGATGCCCTTGGTGGTGGTATGATCTCCTTCAGAATCAAGGGTGGTGCTGAAGCTGCT TCCAAGTTCGCCTCCTCCACAAGACTGTTCACATTGGCCGAATCCCTTGGTGGTATCGAA TCTCTATTGGAAGTGCCCGCTGTGATGACCCACGGTGGTATCCCAAAGGAGGCCAGAGAG GCCTCTGGTGTTTTTGACGACTTGGTTAGAATCTCTGTCGGTATTGAAGACACTGACGAT CTTTTGGAAGACATCAAGCAAGCCTTGAAACAAGCCACCAACTAA
Protein Properties
Pfam Domain Function
Protein Residues394
Protein Molecular Weight42541.69922
Protein Theoretical pI6.52
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cystathionine gamma-lyase MTLQESDKFATKAIHAGEHVDVHGSVIEPISLSTTFKQSSPANPIGTYEYSRSQNPNREN LERAVAALENAQYGLAFSSGSATTATILQSLPQGSHAVSIGDVYGGTHRYFTKVANAHGV ETSFTNDLLNDLPQLIKENTKLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILVVDN TFLSPYISNPLNFGADIVVHSATKYINGHSDVVLGVLATNNKPLYERLQFLQNAIGAIPS PFDAWLTHRGLKTLHLRVRQAALSANKIAEFLAADKENVVAVNYPGLKTHPNYDVVLKQH RDALGGGMISFRIKGGAEAASKFASSTRLFTLAESLGGIESLLEVPAVMTHGGIPKEARE ASGVFDDLVRISVGIEDTDDLLEDIKQALKQATN
References
External Links
ResourceLink
Saccharomyces Genome Database CYS3
Uniprot IDP31373
Uniprot NameCYS3_YEAST
GenBank Gene IDD14135
Genebank Protein ID416164
PDB ID
1N8P
General Reference
  • Ono, B., Tanaka, K., Naito, K., Heike, C., Shinoda, S., Yamamoto, S., Ohmori, S., Oshima, T., Toh-e, A. (1992). "Cloning and characterization of the CYS3 (CYI1) gene of Saccharomyces cerevisiae." J Bacteriol 174:3339-3347.1577698
  • Yamagata, S., D'Andrea, R. J., Fujisaki, S., Isaji, M., Nakamura, K. (1993). "Cloning and bacterial expression of the CYS3 gene encoding cystathionine gamma-lyase of Saccharomyces cerevisiae and the physicochemical and enzymatic properties of the protein." J Bacteriol 175:4800-4808.8335636
  • Barton, A. B., Kaback, D. B., Clark, M. W., Keng, T., Ouellette, B. F., Storms, R. K., Zeng, B., Zhong, W., Fortin, N., Delaney, S., et, a. l. .. (1993). "Physical localization of yeast CYS3, a gene whose product resembles the rat gamma-cystathionase and Escherichia coli cystathionine gamma-synthase enzymes." Yeast 9:363-369.8511966
  • Ouellette, B. F., Clark, M. W., Keng, T., Storms, R. K., Zhong, W., Zeng, B., Fortin, N., Delaney, S., Barton, A., Kaback, D. B., et, a. l. .. (1993). "Sequencing of chromosome I from Saccharomyces cerevisiae: analysis of a 32 kb region between the LTE1 and SPO7 genes." Genome 36:32-42.8458570
  • Bussey, H., Kaback, D. B., Zhong, W., Vo, D. T., Clark, M. W., Fortin, N., Hall, J., Ouellette, B. F., Keng, T., Barton, A. B., et, a. l. .. (1995). "The nucleotide sequence of chromosome I from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 92:3809-3813.7731988
  • Ono, B., Ishii, N., Naito, K., Miyoshi, S., Shinoda, S., Yamamoto, S., Ohmori, S. (1993). "Cystathionine gamma-lyase of Saccharomyces cerevisiae: structural gene and cystathionine gamma-synthase activity." Yeast 9:389-397.8511969
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Messerschmidt, A., Worbs, M., Steegborn, C., Wahl, M. C., Huber, R., Laber, B., Clausen, T. (2003). "Determinants of enzymatic specificity in the Cys-Met-metabolism PLP-dependent enzymes family: crystal structure of cystathionine gamma-lyase from yeast and intrafamiliar structure comparison." Biol Chem 384:373-386.12715888