You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInorganic pyrophosphatase, mitochondrial
Synonyms
  • Pyrophosphate phospho-hydrolase
  • PPase
Gene NamePPA2
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionInvolved in energy production. Its activity is stimulated by uncouplers of ATP synthesis
Cellular LocationMitochondrion
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG Reactions
Pyrophosphate + waterphosphate + hydron
Metabolites
YMDB IDNameView
YMDB00219PyrophosphateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
hydrolase activity, acting on acid anhydrides
binding
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
pyrophosphatase activity
inorganic diphosphatase activity
ion binding
cation binding
metal ion binding
catalytic activity
hydrolase activity
magnesium ion binding
Process
phosphorus metabolic process
phosphate metabolic process
metabolic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR267W
Gene Sequence>933 bp ATGAATTTATTACGAATGAATGCTTTAACAAGCAAGGCTAGGTCAATAGAACGGTTAAAA CAAACATTGAATATTTTATCCATTCGTAATCATAGACAATTCAGCACCATTCAACAAGGC AGCAAATATACCCTCGGGTTTAAGAAATACTTGACATTATTAAATGGAGAGGTTGGTTCT TTTTTCCATGATGTCCCTTTAGATTTGAATGAACATGAAAAGACCGTAAATATGATTGTT GAAGTACCAAGATGGACAACTGGAAAATTTGAAATATCCAAAGAACTTAGGTTCAATCCG ATCGTTCAAGATACGAAGAATGGCAAGCTTAGGTTCGTGAACAATATCTTTCCCTATCAC GGCTATATACACAACTATGGTGCTATTCCCCAAACATGGGAAGATCCCACAATTGAACAT AAACTGGGGAAGTGTGACGTGGCTTTGAAAGGTGACAATGATCCTCTTGATTGTTGCGAA ATCGGTTCGGATGTTTTGGAAATGGGTTCCATTAAAAAGGTCAAGGTATTAGGATCACTC GCTTTAATTGATGATGGAGAATTGGATTGGAAGGTCATAGTGATCGACGTAAATGATCCT TTATCCTCTAAAATAGATGACTTGGAAAAAATTGAGGAGTACTTTCCTGGGATTCTAGAT ACGACTAGGGAGTGGTTTAGAAAGTATAAAGTTCCAGCAGGGAAGCCATTAAATAGTTTC GCCTTTCATGAACAGTATCAAAATTCCAATAAAACCATCCAAACTATAAAGAAATGTCAC AATTCGTGGAAAAACCTCATTTCAGGATCACTCCAGGAGAAGTATGACAACCTGCCTAAT ACAGAAAGGGCTGGTAATGGTGTCACACTTGAAGATAGTGTTAAACCCCCTTCTCAAATA CCGCCTGAGGTGCAAAAATGGTATTACGTTTAA
Protein Properties
Pfam Domain Function
Protein Residues310
Protein Molecular Weight35572.39844
Protein Theoretical pI7.6
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Inorganic pyrophosphatase, mitochondrial MNLLRMNALTSKARSIERLKQTLNILSIRNHRQFSTIQQGSKYTLGFKKYLTLLNGEVGS FFHDVPLDLNEHEKTVNMIVEVPRWTTGKFEISKELRFNPIVQDTKNGKLRFVNNIFPYH GYIHNYGAIPQTWEDPTIEHKLGKCDVALKGDNDPLDCCEIGSDVLEMGSIKKVKVLGSL ALIDDGELDWKVIVIDVNDPLSSKIDDLEKIEEYFPGILDTTREWFRKYKVPAGKPLNSF AFHEQYQNSNKTIQTIKKCHNSWKNLISGSLQEKYDNLPNTERAGNGVTLEDSVKPPSQI PPEVQKWYYV
References
External Links
ResourceLink
Saccharomyces Genome Database PPA2
Uniprot IDP28239
Uniprot NameIPYR2_YEAST
GenBank Gene IDM81880
Genebank Protein ID172223
General Reference
  • Lundin, M., Baltscheffsky, H., Ronne, H. (1991). "Yeast PPA2 gene encodes a mitochondrial inorganic pyrophosphatase that is essential for mitochondrial function." J Biol Chem 266:12168-12172.1648084
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Vihinen, M., Lundin, M., Baltscheffsky, H. (1992). "Computer modeling of two inorganic pyrophosphatases." Biochem Biophys Res Commun 186:122-128.1321599