You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameElongation of fatty acids protein 2
Synonyms
  • Protein GNS1
  • v-SNARE bypass mutant gene 2 protein
Gene NameFEN1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in fatty acid elongase activity
Specific FunctionInvolved in synthesis of 1,3-beta-glucan. Could be a subunit of 1,3-beta-glucan synthase. Could be also a component of the membrane bound fatty acid elongation systems that produce the 26-carbon very long chain fatty acids that are precursors for ceramide and sphingolipids. Appears to be involved in the elongation of fatty acids up to 24 carbons. Appears to have the highest affinity for substrates with chain length less than 22 carbons
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00533malonyl-CoAShow
YMDB00682stearic acidShow
YMDB00684lignoceric acidShow
YMDB00785cerotic acidShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00912Carbon dioxideShow
GO Classification
Component
membrane part
intrinsic to membrane
integral to membrane
cell part
Function
Not Available
Process
Not Available
Gene Properties
Chromosome Locationchromosome 3
LocusYCR034W
Gene Sequence>1044 bp ATGAATTCACTCGTTACTCAATATGCTGCTCCGTTGTTCGAGCGTTATCCCCAACTTCAT GACTATTTACCAACTTTGGAGCGACCATTTTTTAATATTTCGTTGTGGGAACATTTCGAT GATGTCGTCACTCGTGTAACTAACGGTAGATTTGTTCCAAGCGAATTCCAATTCATTGCA GGTGAATTACCATTAAGCACTTTGCCCCCTGTGCTATACGCCATCACTGCCTATTACGTT ATTATTTTTGGTGGCAGGTTTTTGTTAAGTAAGTCGAAACCATTTAAATTAAATGGCCTT TTCCAATTGCATAATTTGGTTTTAACTTCACTTTCATTGACGCTTTTATTGCTTATGGTT GAACAATTAGTGCCAATTATTGTTCAGCACGGGTTATACTTCGCTATCTGTAATATTGGT GCTTGGACTCAACCGCTCGTTACATTATATTACATGAATTACATTGTCAAGTTTATTGAA TTTATAGACACCTTTTTCTTGGTGCTAAAACATAAAAAATTGACATTTTTGCATACTTAT CACCATGGCGCTACTGCCTTATTATGTTACACCCAATTGATGGGCACCACATCTATTTCT TGGGTCCCTATTTCATTGAACCTTGGTGTTCACGTGGTTATGTATTGGTACTATTTCTTG GCTGCCAGAGGCATCAGGGTCTGGTGGAAGGAATGGGTTACCAGATTTCAAATTATCCAA TTTGTTTTGGATATCGGTTTCATATATTTTGCTGTCTACCAAAAAGCAGTTCACTTGTAT TTCCCAATTTTGCCACATTGTGGTGACTGTGTGGGTTCAACAACTGCCACCTTTGCAGGT TGTGCCATTATTTCTTCATATTTGGTACTATTTATTTCATTTTACATTAACGTTTATAAA CGTAAAGGCACCAAAACCAGTAGAGTGGTAAAGCGTGCCCACGGCGGTGTTGCCGCAAAG GTTAATGAGTATGTTAACGTTGACTTGAAAAACGTTCCTACTCCATCTCCATCACCAAAA CCTCAACACAGAAGAAAAAGGTAA
Protein Properties
Pfam Domain Function
Protein Residues347
Protein Molecular Weight40001.80078
Protein Theoretical pI9.83
Signalling Regions
  • None
Transmembrane Regions
  • 63-83
  • 108-128
  • 201-221
  • 245-265
  • 276-296
Protein Sequence>Elongation of fatty acids protein 2 MNSLVTQYAAPLFERYPQLHDYLPTLERPFFNISLWEHFDDVVTRVTNGRFVPSEFQFIA GELPLSTLPPVLYAITAYYVIIFGGRFLLSKSKPFKLNGLFQLHNLVLTSLSLTLLLLMV EQLVPIIVQHGLYFAICNIGAWTQPLVTLYYMNYIVKFIEFIDTFFLVLKHKKLTFLHTY HHGATALLCYTQLMGTTSISWVPISLNLGVHVVMYWYYFLAARGIRVWWKEWVTRFQIIQ FVLDIGFIYFAVYQKAVHLYFPILPHCGDCVGSTTATFAGCAIISSYLVLFISFYINVYK RKGTKTSRVVKRAHGGVAAKVNEYVNVDLKNVPTPSPSPKPQHRRKR
References
External Links
ResourceLink
Saccharomyces Genome Database FEN1
Uniprot IDP25358
Uniprot NameELO2_YEAST
GenBank Gene IDAF012655
Genebank Protein ID2654761
General Reference
  • David, D., Sundarababu, S., Gerst, J. E. (1998). "Involvement of long chain fatty acid elongation in the trafficking of secretory vesicles in yeast." J Cell Biol 143:1167-1182.9832547
  • Thierry, A., Fairhead, C., Dujon, B. (1990). "The complete sequence of the 8.2 kb segment left of MAT on chromosome III reveals five ORFs, including a gene for a yeast ribokinase." Yeast 6:521-534.1964349
  • Wicksteed, B. L., Roberts, A. B., Sagliocco, F. A., Brown, A. J. (1991). "The complete sequence of a 7.5 kb region of chromosome III from Saccharomyces cerevisiae that lies between CRY1 and MAT." Yeast 7:761-772.1776366
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • el-Sherbeini, M., Clemas, J. A. (1995). "Cloning and characterization of GNS1: a Saccharomyces cerevisiae gene involved in synthesis of 1,3-beta-glucan in vitro." J Bacteriol 177:3227-3234.7768822
  • Oh, C. S., Toke, D. A., Mandala, S., Martin, C. E. (1997). "ELO2 and ELO3, homologues of the Saccharomyces cerevisiae ELO1 gene, function in fatty acid elongation and are required for sphingolipid formation." J Biol Chem 272:17376-17384.9211877
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956