You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSterol 24-C-methyltransferase
Synonyms
  • Delta(24)-sterol C-methyltransferase
Gene NameERG6
Enzyme Class
Biological Properties
General FunctionInvolved in methyltransferase activity
Specific FunctionCatalyzes the methyl transfer from S-adenosyl-methionine to the C-24 of zymosterol to form fecosterol
Cellular LocationNot Available
SMPDB Pathways
Steroid biosynthesisPW002482 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
zymosterol + S-Adenosyl-L-methionine24-methylidene-5alpha-cholest-8-en-3beta-ol + S-Adenosylhomocysteine + hydron
KEGG Reactions
zymosterol + S-Adenosylmethionine24-methylidene-5alpha-cholest-8-en-3beta-ol + S-Adenosylhomocysteine + hydron
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB0054524-methylidene-5alpha-cholest-8-en-3beta-olShow
YMDB00548zymosterolShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
transferase activity, transferring one-carbon groups
methyltransferase activity
catalytic activity
transferase activity
Process
primary metabolic process
lipid metabolic process
steroid metabolic process
steroid biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYML008C
Gene Sequence>1152 bp ATGAGTGAAACAGAATTGAGAAAAAGACAGGCCCAATTCACTAGGGAGTTACATGGTGAT GATATTGGTAAAAAGACAGGTTTGAGTGCATTGATGTCGAAGAACAACTCTGCCCAAAAG GAAGCCGTTCAGAAGTACTTGAGAAATTGGGATGGTAGAACCGATAAAGATGCCGAAGAA CGTCGTCTTGAGGATTATAATGAAGCCACACATTCCTACTATAACGTCGTTACAGATTTC TATGAATATGGTTGGGGTTCCTCTTTCCATTTCAGCAGATTTTATAAAGGTGAGAGTTTC GCTGCCTCGATAGCAAGACATGAACATTATTTAGCTTACAAGGCTGGTATTCAAAGAGGC GATTTAGTTCTCGACGTTGGTTGTGGTGTTGGGGGCCCAGCAAGAGAGATTGCAAGATTT ACCGGTTGTAACGTCATCGGTCTAAACAATAACGATTACCAAATTGCCAAGGCAAAATAT TACGCTAAAAAATACAATTTGAGTGACCAAATGGACTTTGTAAAGGGTGATTTCATGAAA ATGGATTTCGAAGAAAACACTTTCGACAAAGTTTATGCAATTGAGGCCACATGTCACGCT CCAAAATTAGAAGGTGTATACAGCGAAATCTACAAGGTTTTGAAACCGGGTGGTACCTTT GCTGTTTACGAATGGGTAATGACTGATAAATATGACGAAAACAATCCTGAACATAGAAAG ATCGCTTATGAAATTGAACTAGGTGATGGTATCCCAAAGATGTTCCATGTCGACGTGGCT AGGAAAGCATTGAAGAACTGTGGTTTCGAAGTCCTCGTTAGCGAAGACCTGGCGGACAAT GATGATGAAATCCCTTGGTATTACCCATTAACTGGTGAGTGGAAGTACGTTCAAAACTTA GCTAATTTGGCCACATTTTTCAGAACTTCTTACTTGGGTAGACAATTTACTACAGCAATG GTTACTGTAATGGAAAAATTAGGTCTAGCCCCAGAAGGTTCCAAGGAAGTTACTGCTGCT CTAGAAAATGCTGCGGTTGGTTTAGTTGCCGGTGGTAAGTCCAAGTTATTCACTCCAATG ATGCTTTTCGTCGCTAGGAAGCCAGAAAACGCCGAAACCCCCTCCCAAACTTCCCAAGAA GCAACTCAATAA
Protein Properties
Pfam Domain Function
Protein Residues383
Protein Molecular Weight43430.5
Protein Theoretical pI5.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Sterol 24-C-methyltransferase MSETELRKRQAQFTRELHGDDIGKKTGLSALMSKNNSAQKEAVQKYLRNWDGRTDKDAEE RRLEDYNEATHSYYNVVTDFYEYGWGSSFHFSRFYKGESFAASIARHEHYLAYKAGIQRG DLVLDVGCGVGGPAREIARFTGCNVIGLNNNDYQIAKAKYYAKKYNLSDQMDFVKGDFMK MDFEENTFDKVYAIEATCHAPKLEGVYSEIYKVLKPGGTFAVYEWVMTDKYDENNPEHRK IAYEIELGDGIPKMFHVDVARKALKNCGFEVLVSEDLADNDDEIPWYYPLTGEWKYVQNL ANLATFFRTSYLGRQFTTAMVTVMEKLGLAPEGSKEVTAALENAAVGLVAGGKSKLFTPM MLFVARKPENAETPSQTSQEATQ
References
External Links
ResourceLink
Saccharomyces Genome Database ERG6
Uniprot IDP25087
Uniprot NameERG6_YEAST
GenBank Gene IDX74249
Genebank Protein ID396515
General Reference
  • Hardwick, K. G., Pelham, H. R. (1994). "SED6 is identical to ERG6, and encodes a putative methyltransferase required for ergosterol synthesis." Yeast 10:265-269.8203167
  • Welihinda, A. A., Beavis, A. D., Trumbly, R. J. (1994). "Mutations in LIS1 (ERG6) gene confer increased sodium and lithium uptake in Saccharomyces cerevisiae." Biochim Biophys Acta 1193:107-117.8038180
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hussain, M., Lenard, J. (1991). "Characterization of PDR4, a Saccharomyces cerevisiae gene that confers pleiotropic drug resistance in high-copy number: identity with YAP1, encoding a transcriptional activator [corrected]." Gene 101:149-152.2060792
  • Garrels, J. I., McLaughlin, C. S., Warner, J. R., Futcher, B., Latter, G. I., Kobayashi, R., Schwender, B., Volpe, T., Anderson, D. S., Mesquita-Fuentes, R., Payne, W. E. (1997). "Proteome studies of Saccharomyces cerevisiae: identification and characterization of abundant proteins." Electrophoresis 18:1347-1360.9298649
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Mo, C., Valachovic, M., Bard, M. (2004). "The ERG28-encoded protein, Erg28p, interacts with both the sterol C-4 demethylation enzyme complex as well as the late biosynthetic protein, the C-24 sterol methyltransferase (Erg6p)." Biochim Biophys Acta 1686:30-36.15522820
  • Mo, C., Bard, M. (2005). "Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex." J Lipid Res 46:1991-1998.15995173
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956