You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSterol 24-C-methyltransferase
Synonyms
  • Delta(24)-sterol C-methyltransferase
Gene NameERG6
Enzyme Class
Biological Properties
General FunctionInvolved in methyltransferase activity
Specific FunctionCatalyzes the methyl transfer from S-adenosyl-methionine to the C-24 of zymosterol to form fecosterol
Cellular LocationNot Available
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(12:0)PW002548 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(16:0)PW002550 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(18:0)PW002551 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
zymosterol + S-Adenosyl-L-methionine24-methylidene-5alpha-cholest-8-en-3beta-ol + S-Adenosylhomocysteine + hydron
KEGG Reactions
zymosterol + S-Adenosylmethionine24-methylidene-5alpha-cholest-8-en-3beta-ol + S-Adenosylhomocysteine + hydron
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB0054524-methylidene-5alpha-cholest-8-en-3beta-olShow
YMDB00548zymosterolShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
methyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
Process
primary metabolic process
lipid metabolic process
steroid metabolic process
steroid biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYML008C
Gene Sequence>1152 bp ATGAGTGAAACAGAATTGAGAAAAAGACAGGCCCAATTCACTAGGGAGTTACATGGTGAT GATATTGGTAAAAAGACAGGTTTGAGTGCATTGATGTCGAAGAACAACTCTGCCCAAAAG GAAGCCGTTCAGAAGTACTTGAGAAATTGGGATGGTAGAACCGATAAAGATGCCGAAGAA CGTCGTCTTGAGGATTATAATGAAGCCACACATTCCTACTATAACGTCGTTACAGATTTC TATGAATATGGTTGGGGTTCCTCTTTCCATTTCAGCAGATTTTATAAAGGTGAGAGTTTC GCTGCCTCGATAGCAAGACATGAACATTATTTAGCTTACAAGGCTGGTATTCAAAGAGGC GATTTAGTTCTCGACGTTGGTTGTGGTGTTGGGGGCCCAGCAAGAGAGATTGCAAGATTT ACCGGTTGTAACGTCATCGGTCTAAACAATAACGATTACCAAATTGCCAAGGCAAAATAT TACGCTAAAAAATACAATTTGAGTGACCAAATGGACTTTGTAAAGGGTGATTTCATGAAA ATGGATTTCGAAGAAAACACTTTCGACAAAGTTTATGCAATTGAGGCCACATGTCACGCT CCAAAATTAGAAGGTGTATACAGCGAAATCTACAAGGTTTTGAAACCGGGTGGTACCTTT GCTGTTTACGAATGGGTAATGACTGATAAATATGACGAAAACAATCCTGAACATAGAAAG ATCGCTTATGAAATTGAACTAGGTGATGGTATCCCAAAGATGTTCCATGTCGACGTGGCT AGGAAAGCATTGAAGAACTGTGGTTTCGAAGTCCTCGTTAGCGAAGACCTGGCGGACAAT GATGATGAAATCCCTTGGTATTACCCATTAACTGGTGAGTGGAAGTACGTTCAAAACTTA GCTAATTTGGCCACATTTTTCAGAACTTCTTACTTGGGTAGACAATTTACTACAGCAATG GTTACTGTAATGGAAAAATTAGGTCTAGCCCCAGAAGGTTCCAAGGAAGTTACTGCTGCT CTAGAAAATGCTGCGGTTGGTTTAGTTGCCGGTGGTAAGTCCAAGTTATTCACTCCAATG ATGCTTTTCGTCGCTAGGAAGCCAGAAAACGCCGAAACCCCCTCCCAAACTTCCCAAGAA GCAACTCAATAA
Protein Properties
Pfam Domain Function
Protein Residues383
Protein Molecular Weight43430.5
Protein Theoretical pI5.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Sterol 24-C-methyltransferase MSETELRKRQAQFTRELHGDDIGKKTGLSALMSKNNSAQKEAVQKYLRNWDGRTDKDAEE RRLEDYNEATHSYYNVVTDFYEYGWGSSFHFSRFYKGESFAASIARHEHYLAYKAGIQRG DLVLDVGCGVGGPAREIARFTGCNVIGLNNNDYQIAKAKYYAKKYNLSDQMDFVKGDFMK MDFEENTFDKVYAIEATCHAPKLEGVYSEIYKVLKPGGTFAVYEWVMTDKYDENNPEHRK IAYEIELGDGIPKMFHVDVARKALKNCGFEVLVSEDLADNDDEIPWYYPLTGEWKYVQNL ANLATFFRTSYLGRQFTTAMVTVMEKLGLAPEGSKEVTAALENAAVGLVAGGKSKLFTPM MLFVARKPENAETPSQTSQEATQ
References
External Links
ResourceLink
Saccharomyces Genome Database ERG6
Uniprot IDP25087
Uniprot NameERG6_YEAST
GenBank Gene IDX74249
Genebank Protein ID396515
General Reference
  • Hardwick, K. G., Pelham, H. R. (1994). "SED6 is identical to ERG6, and encodes a putative methyltransferase required for ergosterol synthesis." Yeast 10:265-269.8203167
  • Welihinda, A. A., Beavis, A. D., Trumbly, R. J. (1994). "Mutations in LIS1 (ERG6) gene confer increased sodium and lithium uptake in Saccharomyces cerevisiae." Biochim Biophys Acta 1193:107-117.8038180
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hussain, M., Lenard, J. (1991). "Characterization of PDR4, a Saccharomyces cerevisiae gene that confers pleiotropic drug resistance in high-copy number: identity with YAP1, encoding a transcriptional activator [corrected]." Gene 101:149-152.2060792
  • Garrels, J. I., McLaughlin, C. S., Warner, J. R., Futcher, B., Latter, G. I., Kobayashi, R., Schwender, B., Volpe, T., Anderson, D. S., Mesquita-Fuentes, R., Payne, W. E. (1997). "Proteome studies of Saccharomyces cerevisiae: identification and characterization of abundant proteins." Electrophoresis 18:1347-1360.9298649
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Mo, C., Valachovic, M., Bard, M. (2004). "The ERG28-encoded protein, Erg28p, interacts with both the sterol C-4 demethylation enzyme complex as well as the late biosynthetic protein, the C-24 sterol methyltransferase (Erg6p)." Biochim Biophys Acta 1686:30-36.15522820
  • Mo, C., Bard, M. (2005). "Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex." J Lipid Res 46:1991-1998.15995173
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956