Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameS-adenosylmethionine decarboxylase proenzyme
Synonyms
  • AdoMetDC
  • SAMDC
  • S-adenosylmethionine decarboxylase alpha chain
  • S-adenosylmethionine decarboxylase beta chain
Gene NameSPE2
Enzyme Class
Biological Properties
General FunctionInvolved in adenosylmethionine decarboxylase activity
Specific FunctionS-adenosylmethionine decarboxylase is essential for normal growth, sporulation, maintenance of ds-RNA virus, biosynthesis of spermine and spermidine
Cellular LocationNot Available
SMPDB Pathways
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
Cysteine and methionine metabolismec00270 Map00270
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
S-Adenosyl-L-methionine + hydronS-Adenosylmethioninamine + Carbon dioxide
KEGG Reactions
hydron + S-AdenosylmethionineS-Adenosylmethioninamine + Carbon dioxide
Metabolites
YMDB IDNameView
YMDB00130S-AdenosylmethioninamineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
YMDB00980(5-Deoxy-5-adenosyl)(3-aminopropyl)methylsulfoniumShow
GO Classification
Component
Not Available
Function
adenosylmethionine decarboxylase activity
catalytic activity
lyase activity
carbon-carbon lyase activity
carboxy-lyase activity
Process
cellular biogenic amine metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
spermidine biosynthetic process
metabolic process
polyamine metabolic process
polyamine biosynthetic process
spermine biosynthetic process
cellular amino acid derivative metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOL052C
Gene Sequence>1191 bp ATGACTGTCACCATAAAAGAATTGACTAACCACAACTACATTGACCACGAACTATCAGCC ACTTTAGACTCAACGGATGCGTTCGAGGGTCCCGAGAAGTTGCTGGAAATCTGGTTCTTC CCTCACAAGAAGTCCATCACGACCGAAAAGACATTAAGAAATATTGGCATGGATAGATGG ATCGAGATTTTGAAATTAGTGAAATGCGAAGTTCTTTCCATGAAGAAGACTAAAGAACTG GATGCCTTTTTGTTGAGTGAGTCTTCCCTCTTCGTCTTCGATCACAAATTGACGATGAAG ACGTGCGGTACTACAACCACATTGTTCTGTCTCGAAAAGCTTTTCCAGATCGTTGAGCAA GAGTTATCGTGGGCTTTCCGCACAACACAAGGGGGCAAGTACAAACCATTTAAAGTGTTT TATTCTAGACGATGTTTCCTTTTCCCCTGTAAGCAAGCCGCTATCCATCAAAACTGGGCT GACGAAGTCGACTATTTGAACAAATTTTTCGACAATGGTAAAAGTTATTCCGTGGGAAGA AATGACAAGAGCAACCACTGGAACCTGTACGTCACCGAGACGGACCGCTCCACACCTAAG GGAAAGGAGTACATCGAGGATGACGACGAAACTTTCGAAGTACTGATGACGGAGCTGGAC CCAGAATGCGCTAGTAAGTTTGTTTGCGGGCCTGAGGCATCCACAACCGCTCTCGTGGAG CCAAACGAAGATAAGGGCCACAACCTCGGCTACCAAATGACTAAAAATACAAGGCTTGAC GAAATATATGTCAACTCGGCCCAAGACTCCGATTTATCATTTCACCACGATGCATTTGCG TTCACGCCATGTGGATACTCATCCAATATGATTCTCGCTGAAAAATACTATTACACCCTG CACGTGACTCCGGAAAAGGGTTGGTCTTACGCCTCTTTCGAAAGTAACATACCCGTATTT GACATTTCCCAAGGGAAGCAAGACAACTTGGACGTTCTTCTACATATTCTGAACGTTTTT CAACCAAGAGAGTTCTCGATGACCTTTTTTACCAAAAATTATCAGAACCAATCCTTCCAA AAACTACTAAGCATCAACGAGTCACTGCCCGACTACATCAAGTTAGACAAAATTGTTTAT GATCTGGACGACTACCACCTTTTCTATATGAAATTGCAGAAGAAAATATGA
Protein Properties
Pfam Domain Function
Protein Residues396
Protein Molecular Weight46232.0
Protein Theoretical pI5.32
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>S-adenosylmethionine decarboxylase proenzyme MTVTIKELTNHNYIDHELSATLDSTDAFEGPEKLLEIWFFPHKKSITTEKTLRNIGMDRW IEILKLVKCEVLSMKKTKELDAFLLSESSLFVFDHKLTMKTCGTTTTLFCLEKLFQIVEQ ELSWAFRTTQGGKYKPFKVFYSRRCFLFPCKQAAIHQNWADEVDYLNKFFDNGKSYSVGR NDKSNHWNLYVTETDRSTPKGKEYIEDDDETFEVLMTELDPECASKFVCGPEASTTALVE PNEDKGHNLGYQMTKNTRLDEIYVNSAQDSDLSFHHDAFAFTPCGYSSNMILAEKYYYTL HVTPEKGWSYASFESNIPVFDISQGKQDNLDVLLHILNVFQPREFSMTFFTKNYQNQSFQ KLLSINESLPDYIKLDKIVYDLDDYHLFYMKLQKKI
References
External Links
ResourceLink
Saccharomyces Genome Database SPE2
Uniprot IDP21182
Uniprot NameDCAM_YEAST
GenBank Gene IDM38434
Genebank Protein ID171055
General Reference
  • Kashiwagi, K., Taneja, S. K., Liu, T. Y., Tabor, C. W., Tabor, H. (1990). "Spermidine biosynthesis in Saccharomyces cerevisiae. Biosynthesis and processing of a proenzyme form of S-adenosylmethionine decarboxylase." J Biol Chem 265:22321-22328.2266128
  • Mannhaupt, G., Vetter, I., Schwarzlose, C., Mitzel, S., Feldmann, H. (1996). "Analysis of a 26 kb region on the left arm of yeast chromosome XV." Yeast 12:67-76.8789261
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106