You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAcyl-CoA desaturase 1
Synonyms
  • Fatty acid desaturase 1
  • Stearoyl-CoA desaturase 1
Gene NameOLE1
Enzyme Class
Biological Properties
General FunctionInvolved in stearoyl-CoA 9-desaturase activity
Specific FunctionUtilizes O(2) and electrons from the reduced cytochrome b(5) domain to catalyze the insertion of a double bond into a spectrum of fatty acyl-CoA substrates (Probable)
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein (Probable)
SMPDB Pathways
Biosynthesis of unsaturated fatty acidsPW002403 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Biosynthesis of unsaturated fatty acidsec01040 Map01040
SMPDB ReactionsNot Available
KEGG Reactions
Palmityl-CoA + NADPH + hydron + oxygenwater + NADP + hexadec-2-enoyl-CoA
stearoyl-CoA + NADPH + hydron + oxygenwater + NADP + oleoyl-CoA
Metabolites
YMDB IDNameView
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00469hexadec-2-enoyl-CoAShow
YMDB00527palmitoyl-CoAShow
YMDB00538stearoyl-CoAShow
YMDB00539oleoyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00900oxygenShow
GO Classification
Component
cell part
organelle
membrane
membrane-bounded organelle
intracellular membrane-bounded organelle
endoplasmic reticulum
Function
catalytic activity
binding
ion binding
cation binding
metal ion binding
oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen
transition metal ion binding
oxidoreductase activity, acting on paired donors, with oxidation of a pair of donors resulting in the reduction of molecular oxygen to two molecules of water
iron ion binding
stearoyl-CoA 9-desaturase activity
oxidoreductase activity
heme binding
Process
oxoacid metabolic process
metabolic process
carboxylic acid metabolic process
cellular metabolic process
lipid metabolic process
monocarboxylic acid metabolic process
primary metabolic process
fatty acid metabolic process
fatty acid biosynthetic process
oxidation reduction
organic acid metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL055W
Gene Sequence>1533 bp ATGCCAACTTCTGGAACTACTATTGAATTGATTGACGACCAATTTCCAAAGGATGACTCT GCCAGCAGTGGCATTGTCGACGAAGTCGACTTAACGGAAGCTAATATTTTGGCTACTGGT TTGAATAAGAAAGCACCAAGAATTGTCAACGGTTTTGGTTCTTTAATGGGCTCCAAGGAA ATGGTTTCCGTGGAATTCGACAAGAAGGGAAACGAAAAGAAGTCCAATTTGGATCGTCTG CTAGAAAAGGACAACCAAGAAAAAGAAGAAGCTAAAACTAAAATTCACATCTCCGAACAA CCATGGACTTTGAATAACTGGCACCAACATTTGAACTGGTTGAACATGGTTCTTGTTTGT GGTATGCCAATGATTGGTTGGTACTTCGCTCTCTCTGGTAAAGTACCTTTGCATTTAAAC GTTTTCCTTTTCTCCGTTTTCTACTACGCTGTCGGTGGTGTTTCTATTACTGCCGGTTAC CATAGATTATGGTCTCACAGATCTTACTCCGCTCACTGGCCATTGAGATTATTCTACGCT ATCTTCGGTTGTGCTTCCGTTGAAGGGTCCGCTAAATGGTGGGGCCACTCTCACAGAATT CACCATCGTTACACTGATACCTTGAGAGATCCTTATGACGCTCGTAGAGGTCTATGGTAC TCCCACATGGGATGGATGCTTTTGAAGCCAAATCCAAAATACAAGGCTAGAGCTGATATT ACCGATATGACTGATGATTGGACCATTAGATTCCAACACAGACACTACATCTTGTTGATG TTATTAACCGCTTTCGTCATTCCAACTCTTATCTGTGGTTACTTTTTCAACGACTATATG GGTGGTTTGATCTATGCCGGTTTTATTCGTGTCTTTGTCATTCAACAAGCTACCTTTTGC ATTAACTCCATGGCTCATTACATCGGTACCCAACCATTCGATGACAGAAGAACCCCTCGT GACAACTGGATTACTGCCATTGTTACTTTCGGTGAAGGTTACCATAACTTCCACCACGAA TTCCCAACTGATTACAGAAACGCTATTAAGTGGTACCAATACGACCCAACTAAGGTTATC ATCTATTTGACTTCTTTAGTTGGTCTAGCATACGACTTGAAGAAATTCTCTCAAAATGCT ATTGAAGAAGCCTTGATTCAACAAGAACAAAAGAAGATCAATAAAAAGAAGGCTAAGATT AACTGGGGTCCAGTTTTGACTGATTTGCCAATGTGGGACAAACAAACCTTCTTGGCTAAG TCTAAGGAAAACAAGGGTTTGGTTATCATTTCTGGTATTGTTCACGACGTATCTGGTTAT ATCTCTGAACATCCAGGTGGTGAAACTTTAATTAAAACTGCATTAGGTAAGGACGCTACC AAGGCTTTCAGTGGTGGTGTCTACCGTCACTCAAATGCCGCTCAAAATGTCTTGGCTGAT ATGAGAGTGGCTGTTATCAAGGAAAGTAAGAACTCTGCTATTAGAATGGCTAGTAAGAGA GGTGAAATCTACGAAACTGGTAAGTTCTTTTAA
Protein Properties
Pfam Domain Function
Protein Residues510
Protein Molecular Weight58402.60156
Protein Theoretical pI9.33
Signalling Regions
  • None
Transmembrane Regions
  • 113-133
  • 139-159
  • 256-276
  • 281-301
Protein Sequence>Acyl-CoA desaturase 1 MPTSGTTIELIDDQFPKDDSASSGIVDEVDLTEANILATGLNKKAPRIVNGFGSLMGSKE MVSVEFDKKGNEKKSNLDRLLEKDNQEKEEAKTKIHISEQPWTLNNWHQHLNWLNMVLVC GMPMIGWYFALSGKVPLHLNVFLFSVFYYAVGGVSITAGYHRLWSHRSYSAHWPLRLFYA IFGCASVEGSAKWWGHSHRIHHRYTDTLRDPYDARRGLWYSHMGWMLLKPNPKYKARADI TDMTDDWTIRFQHRHYILLMLLTAFVIPTLICGYFFNDYMGGLIYAGFIRVFVIQQATFC INSLAHYIGTQPFDDRRTPRDNWITAIVTFGEGYHNFHHEFPTDYRNAIKWYQYDPTKVI IYLTSLVGLAYDLKKFSQNAIEEALIQQEQKKINKKKAKINWGPVLTDLPMWDKQTFLAK SKENKGLVIISGIVHDVSGYISEHPGGETLIKTALGKDATKAFSGGVYRHSNAAQNVLAD MRVAVIKESKNSAIRMASKRGEIYETGKFF
References
External Links
ResourceLink
Saccharomyces Genome Database OLE1
Uniprot IDP21147
Uniprot NameACO1_YEAST
GenBank Gene IDJ05676
Genebank Protein ID172064
General Reference
  • Stukey, J. E., McDonough, V. M., Martin, C. E. (1990). "The OLE1 gene of Saccharomyces cerevisiae encodes the delta 9 fatty acid desaturase and can be functionally replaced by the rat stearoyl-CoA desaturase gene." J Biol Chem 265:20144-20149.1978720
  • Feuermann, M., de Montigny, J., Potier, S., Souciet, J. L. (1997). "The characterization of two new clusters of duplicated genes suggests a 'Lego' organization of the yeast Saccharomyces cerevisiae chromosomes." Yeast 13:861-869.9234674
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258