You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFatty acid synthase subunit alpha
Synonyms
  • Acyl carrier
  • 3-oxoacyl-[acyl-carrier-protein] reductase
  • Beta-ketoacyl reductase
  • 3-oxoacyl-[acyl-carrier-protein] synthase
  • Beta-ketoacyl synthase
Gene NameFAS2
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionFatty acid synthetase catalyzes the formation of long- chain fatty acids from acetyl-CoA, malonyl-CoA and NADPH. The alpha subunit contains domains for:acyl carrier protein, 3- oxoacyl-[acyl-carrier-protein] reductase, and 3-oxoacyl-[acyl- carrier-protein] synthase. This subunit coordinates the binding of the six beta subunits to the enzyme complex
Cellular LocationNot Available
SMPDB Pathways
Fatty acid biosynthesisPW002458 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Fatty acid biosynthesisec00061 Map00061
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00312Acetyl-CoAShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00533malonyl-CoAShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
binding
holo-[acyl-carrier-protein] synthase activity
C-acyltransferase activity
ion binding
fatty-acyl-CoA synthase activity
cation binding
metal ion binding
oxidoreductase activity
magnesium ion binding
transferase activity, transferring acyl groups
catalytic activity
transferase activity, transferring acyl groups other than amino-acyl groups
transferase activity
acyltransferase activity
transferase activity, transferring phosphorus-containing groups
phosphotransferase activity, for other substituted phosphate groups
Process
macromolecule biosynthetic process
metabolic process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
monocarboxylic acid metabolic process
biosynthetic process
fatty acid metabolic process
cellular metabolic process
fatty acid biosynthetic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL231W
Gene Sequence>5664 bp ATGAAGCCGGAAGTTGAGCAAGAATTAGCTCATATTTTGCTAACTGAATTGTTAGCTTAT CAATTTGCCTCTCCTGTGAGATGGATTGAAACTCAAGATGTTTTTTTGAAGGATTTTAAC ACTGAAAGGGTTGTTGAAATCGGTCCTTCTCCAACTTTGGCTGGGATGGCTCAAAGAACC TTGAAGAATAAATACGAATCTTACGATGCTGCTCTGTCTTTACATAGAGAAATCTTATGC TATTCGAAGGATGCCAAAGAGATTTATTATACCCCAGATCCATCCGAACTAGCTGCAAAG GAAGAGCCCGCTAAGGAAGAAGCTCCTGCTCCAACTCCAGCTGCTAGTGCTCCTGCTCCT GCAGCAGCAGCCCCAGCTCCCGTCGCGGCAGCAGCCCCAGCTGCAGCAGCTGCTGAGATT GCCGATGAACCTGTCAAGGCTTCCCTATTGTTGCACGTTTTGGTTGCTCACAAGTTGAAG AAGTCGTTAGATTCCATTCCAATGTCCAAGACAATCAAAGACTTGGTCGGTGGTAAATCT ACAGTCCAAAATGAAATTTTGGGTGATTTAGGTAAAGAATTTGGTACTACTCCTGAAAAA CCAGAAGAAACTCCATTAGAAGAATTGGCAGAAACTTTCCAAGATACCTTCTCTGGAGCA TTGGGTAAGCAATCTTCCTCGTTATTATCAAGATTAATCTCATCTAAGATGCCTGGTGGG TTTACTATTACTGTCGCTAGAAAATACTTACAAACTCGCTGGGGACTACCATCTGGTAGA CAAGATGGTGTCCTTTTGGTAGCTTTATCTAACGAGCCTGCTGCTCGTCTAGGTTCTGAA GCTGATGCCAAGGCTTTCTTGGACTCCATGGCTCAAAAATACGCTTCCATTGTTGGTGTT GACTTATCATCAGCTGCTAGCGCTAGTGGTGCTGCCGGTGCAGGTGCTGCTGCCGGTGCA GCTATGATCGATGCTGGCGCTCTGGAAGAAATAACCAAAGACCACAAGGTTTTGGCGCGT CAACAACTGCAAGTATTGGCTCGTTATCTAAAAATGGACTTGGATAACGGTGAAAGAAAG TTCTTGAAAGAAAAGGACACTGTTGCTGAACTTCAAGCTCAGTTGGATTACTTGAATGCC GAATTAGGTGAATTCTTTGTTAACGGTGTTGCTACTTCTTTCTCTAGAAAAAAGGCCAGA ACCTTCGATTCTTCCTGGAACTGGGCTAAACAATCTTTATTATCATTATACTTTGAGATA ATTCATGGTGTCTTGAAAAACGTTGATAGAGAGGTTGTTAGTGAAGCTATCAATATCATG AACAGATCTAACGATGCTTTGATTAAATTCATGGAATACCATATCTCTAACACTGATGAA ACAAAAGGTGAAAACTATCAATTGGTTAAAACTCTTGGTGAGCAGTTGATTGAAAACTGT AAACAAGTTTTGGATGTTGATCCAGTTTACAAAGATGTTGCTAAGCCTACCGGTCCAAAA ACTGCTATTGACAAGAACGGTAACATTACATACTCAGAAGAGCCAAGAGAAAAGGTTAGG AAATTATCTCAATACGTACAAGAAATGGCCCTTGGTGGTCCAATCACCAAAGAATCTCAA CCTACTATTGAAGAGGATTTGACTCGTGTTTACAAGGCAATCAGTGCTCAAGCTGATAAA CAAGATATTTCCAGCTCCACCAGGGTTGAATTTGAAAAACTATATAGTGATTTGATGAAG TTCTTGGAAAGCTCCAAAGAAATCGATCCTTCTCAAACAACCCAATTGGCCGGTATGGAT GTTGAGGATGCTTTGGACAAAGATTCCACCAAAGAAGTTGCTTCTTTGCCAAACAAATCT ACCATTTCTAAGACGGTATCTTCAACTATTCCAAGAGAAACTATTCCGTTCTTACATTTG AGAAAGAAGACTCCTGCCGGAGATTGGAAATATGACCGCCAATTGTCTTCTCTTTTCTTA GATGGTTTAGAAAAGGCTGCCTTCAACGGTGTCACCTTCAAGGACAAATACGTCTTGATC ACTGGTGCTGGTAAGGGTTCTATTGGTGCTGAAGTCTTGCAAGGTTTGTTACAAGGTGGT GCTAAGGTTGTTGTTACCACCTCTCGTTTCTCTAAGCAAGTTACAGACTACTACCAATCC ATTTACGCCAAATATGGTGCTAAGGGTTCTACTTTGATTGTTGTTCCATTCAACCAAGGT TCTAAGCAAGACGTTGAAGCTTTGATTGAATTTATCTACGACACTGAAAAGAATGGTGGT TTAGGTTGGGATCTAGATGCTATTATTCCATTCGCGGCCATTCCAGAACAAGGTATTGAA TTAGAACATATTGATTCTAAGTCTGAATTTGCTCATAGAATCATGTTGACCAATATCTTA AGAATGATGGGTTGTGTCAAGAAGCAAAAATCTGCAAGAGGTATTGAAACAAGACCAGCT CAAGTCATTCTACCAATGTCTCCAAACCATGGTACTTTCGGTGGTGATGGTATGTATTCA GAATCCAAGTTGTCTTTGGAAACTTTGTTCAACAGATGGCACTCTGAATCCTGGGCCAAT CAATTAACCGTTTGCGGTGCTATTATTGGTTGGACTAGAGGTACTGGTTTAATGAGCGCT AATAACATCATTGCTGAAGGCATTGAAAAGATGGGTGTTCGTACTTTCTCTCAAAAGGAA ATGGCTTTCAACTTATTGGGTCTATTGACTCCAGAAGTCGTAGAATTGTGCCAAAAATCA CCTGTTATGGCTGACTTGAATGGTGGTTTGCAATTTGTTCCTGAATTGAAGGAATTCACT GCTAAATTGCGTAAAGAGTTGGTTGAAACTTCTGAAGTTAGAAAGGCAGTTTCCATCGAA ACTGCTTTGGAGCATAAGGTTGTCAATGGCAATAGCGCTGATGCTGCATATGCTCAAGTC GAAATTCAACCAAGAGCTAACATTCAACTGGACTTCCCAGAATTGAAACCATACAAACAG GTTAAACAAATTGCTCCCGCTGAGCTTGAAGGTTTGTTGGATTTGGAAAGAGTTATTGTA GTTACCGGTTTTGCTGAAGTCGGCCCATGGGGTTCGGCCAGAACAAGATGGGAAATGGAA GCTTTTGGTGAATTTTCGTTGGAAGGTTGCGTTGAAATGGCCTGGATTATGGGCTTCATT TCATACCATAACGGTAATTTGAAGGGTCGTCCATACACTGGTTGGGTTGATTCCAAAACA AAAGAACCAGTTGATGACAAGGACGTTAAGGCCAAGTATGAAACATCAATCCTAGAACAC AGTGGTATCAGATTGATCGAACCAGAGTTATTCAATGGTTACAACCCAGAAAAGAAGGAA ATGATTCAAGAAGTCATTGTCGAAGAAGACTTGGAACCATTTGAGGCTTCGAAGGAAACT GCCGAACAATTTAAACACCAACATGGTGACAAAGTGGATATCTTCGAAATCCCAGAAACA GGAGAGTACTCTGTTAAGTTACTAAAGGGTGCCACTTTATACATTCCAAAGGCTTTGAGA TTTGACCGTTTGGTTGCAGGTCAAATTCCAACTGGTTGGAATGCTAAGACTTATGGTATC TCTGATGATATCATTTCTCAGGTTGACCCAATCACATTATTCGTTTTGGTCTCTGTTGTG GAAGCATTTATTGCATCTGGTATCACCGACCCATACGAAATGTACAAATACGTACATGTT TCTGAGGTTGGTAACTGTTCTGGTTCTGGTATGGGTGGTGTTTCTGCCTTACGTGGTATG TTTAAGGACCGTTTCAAGGATGAGCCTGTCCAAAATGATATTTTACAAGAATCATTTATC AACACCATGTCCGCTTGGGTTAATATGTTGTTGATTTCCTCATCTGGTCCAATCAAGACA CCTGTTGGTGCCTGTGCCACATCCGTGGAATCTGTTGACATTGGTGTAGAAACCATCTTG TCTGGTAAGGCTAGAATCTGTATTGTCGGTGGTTACGATGATTTCCAAGAAGAAGGCTCC TTTGAGTTCGGTAACATGAAGGCCACTTCCAACACTTTGGAAGAATTTGAACATGGTCGT ACCCCAGCGGAAATGTCCAGACCTGCCACCACTACCCGTAACGGTTTTATGGAAGCTCAA GGTGCTGGTATTCAAATCATCATGCAAGCTGATTTAGCTTTGAAGATGGGTGTGCCAATT TACGGTATTGTTGCCATGGCTGCTACCGCCACCGATAAGATTGGTAGATCTGTGCCAGCT CCAGGTAAGGGTATTTTAACCACTGCTCGTGAACACCACTCCAGTGTTAAGTATGCTTCA CCAAACTTGAACATGAAGTACAGAAAGCGCCAATTGGTTACTCGTGAAGCTCAGATTAAA GATTGGGTAGAAAACGAATTGGAAGCTTTGAAGTTGGAGGCCGAAGAAATTCCAAGCGAA GACCAAAACGAGTTCTTACTTGAACGTACCAGAGAAATCCACAACGAAGCTGAAAGTCAA TTGAGAGCTGCACAACAACAATGGGGTAACGACTTCTACAAGAGGGACCCACGTATTGCT CCATTGAGAGGAGCACTGGCTACTTACGGTTTAACTATTGATGACTTGGGTGTCGCTTCA TTCCACGGTACATCCACAAAGGCTAATGACAAGAACGAATCTGCCACAATTAATGAAATG ATGAAGCATTTGGGTAGATCTGAAGGTAATCCCGTCATTGGTGTTTTCCAAAAGTTCTTG ACTGGTCATCCAAAGGGTGCTGCTGGTGCATGGATGATGAATGGTGCTTTGCAAATTCTA AACAGTGGTATTATTCCAGGTAACCGTAACGCTGATAACGTGGATAAGATCTTGGAGCAA TTTGAATACGTCTTGTACCCATCCAAGACTTTAAAGACCGACGGTGTCAGAGCCGTGTCC ATCACTTCTTTCGGTTTTGGTCAAAAGGGTGGTCAAGCTATTGTGGTTCATCCAGACTAC TTATACGGTGCTATCACTGAAGACAGATACAACGAGTATGTCGCCAAGGTTAGTGCCAGA GAGAAAAGTGCCTACAAATTCTTCCATAATGGTATGATCTACAACAAGTTGTTCGTAAGT AAAGAGCATGCTCCATACACTGATGAATTGGAAGAGGATGTTTACTTGGACCCATTAGCC CGTGTATCTAAGGATAAGAAATCAGGCTCCTTGACTTTCAACTCTAAAAACATCCAAAGC AAGGACAGTTACATCAATGCTAACACCATTGAAACTGCCAAGATGATTGAAAACATGACC AAGGAGAAAGTCTCTAACGGTGGCGTCGGTGTAGATGTTGAATTAATCACTAGCATCAAC GTTGAAAATGATACTTTTATCGAGCGCAATTTCACCCCGCAAGAAATAGAGTACTGCAGC GCGCAGCCTAGTGTGCAAAGCTCTTTCGCTGGGACATGGTCCGCCAAAGAGGCTGTTTTC AAGTCCTTAGGCGTCAAGTCCTTAGGCGGTGGTGCTGCATTGAAAGACATCGAAATCGTA CGCGTTAACAAAAACGCTCCAGCCGTTGAACTGCACGGTAACGCCAAAAAGGCTGCCGAA GAAGCTGGTGTTACCGATGTGAAGGTATCTATTTCTCACGATGACCTCCAAGCTGTCGCG GTCGCCGTTTCTACTAAGAAATAG
Protein Properties
Pfam Domain Function
Protein Residues1887
Protein Molecular Weight206945.0
Protein Theoretical pI5.11
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Fatty acid synthase subunit alpha MKPEVEQELAHILLTELLAYQFASPVRWIETQDVFLKDFNTERVVEIGPSPTLAGMAQRT LKNKYESYDAALSLHREILCYSKDAKEIYYTPDPSELAAKEEPAKEEAPAPTPAASAPAP AAAAPAPVAAAAPAAAAAEIADEPVKASLLLHVLVAHKLKKSLDSIPMSKTIKDLVGGKS TVQNEILGDLGKEFGTTPEKPEETPLEELAETFQDTFSGALGKQSSSLLSRLISSKMPGG FTITVARKYLQTRWGLPSGRQDGVLLVALSNEPAARLGSEADAKAFLDSMAQKYASIVGV DLSSAASASGAAGAGAAAGAAMIDAGALEEITKDHKVLARQQLQVLARYLKMDLDNGERK FLKEKDTVAELQAQLDYLNAELGEFFVNGVATSFSRKKARTFDSSWNWAKQSLLSLYFEI IHGVLKNVDREVVSEAINIMNRSNDALIKFMEYHISNTDETKGENYQLVKTLGEQLIENC KQVLDVDPVYKDVAKPTGPKTAIDKNGNITYSEEPREKVRKLSQYVQEMALGGPITKESQ PTIEEDLTRVYKAISAQADKQDISSSTRVEFEKLYSDLMKFLESSKEIDPSQTTQLAGMD VEDALDKDSTKEVASLPNKSTISKTVSSTIPRETIPFLHLRKKTPAGDWKYDRQLSSLFL DGLEKAAFNGVTFKDKYVLITGAGKGSIGAEVLQGLLQGGAKVVVTTSRFSKQVTDYYQS IYAKYGAKGSTLIVVPFNQGSKQDVEALIEFIYDTEKNGGLGWDLDAIIPFAAIPEQGIE LEHIDSKSEFAHRIMLTNILRMMGCVKKQKSARGIETRPAQVILPMSPNHGTFGGDGMYS ESKLSLETLFNRWHSESWANQLTVCGAIIGWTRGTGLMSANNIIAEGIEKMGVRTFSQKE MAFNLLGLLTPEVVELCQKSPVMADLNGGLQFVPELKEFTAKLRKELVETSEVRKAVSIE TALEHKVVNGNSADAAYAQVEIQPRANIQLDFPELKPYKQVKQIAPAELEGLLDLERVIV VTGFAEVGPWGSARTRWEMEAFGEFSLEGCVEMAWIMGFISYHNGNLKGRPYTGWVDSKT KEPVDDKDVKAKYETSILEHSGIRLIEPELFNGYNPEKKEMIQEVIVEEDLEPFEASKET AEQFKHQHGDKVDIFEIPETGEYSVKLLKGATLYIPKALRFDRLVAGQIPTGWNAKTYGI SDDIISQVDPITLFVLVSVVEAFIASGITDPYEMYKYVHVSEVGNCSGSGMGGVSALRGM FKDRFKDEPVQNDILQESFINTMSAWVNMLLISSSGPIKTPVGACATSVESVDIGVETIL SGKARICIVGGYDDFQEEGSFEFGNMKATSNTLEEFEHGRTPAEMSRPATTTRNGFMEAQ GAGIQIIMQADLALKMGVPIYGIVAMAATATDKIGRSVPAPGKGILTTAREHHSSVKYAS PNLNMKYRKRQLVTREAQIKDWVENELEALKLEAEEIPSEDQNEFLLERTREIHNEAESQ LRAAQQQWGNDFYKRDPRIAPLRGALATYGLTIDDLGVASFHGTSTKANDKNESATINEM MKHLGRSEGNPVIGVFQKFLTGHPKGAAGAWMMNGALQILNSGIIPGNRNADNVDKILEQ FEYVLYPSKTLKTDGVRAVSITSFGFGQKGGQAIVVHPDYLYGAITEDRYNEYVAKVSAR EKSAYKFFHNGMIYNKLFVSKEHAPYTDELEEDVYLDPLARVSKDKKSGSLTFNSKNIQS KDSYINANTIETAKMIENMTKEKVSNGGVGVDVELITSINVENDTFIERNFTPQEIEYCS AQPSVQSSFAGTWSAKEAVFKSLGVKSLGGGAALKDIEIVRVNKNAPAVELHGNAKKAAE EAGVTDVKVSISHDDLQAVAVAVSTKK
References
External Links
ResourceLink
Saccharomyces Genome Database FAS2
Uniprot IDP19097
Uniprot NameFAS2_YEAST
GenBank Gene IDX76890
Genebank Protein ID854531
General Reference
  • Mohamed, A. H., Chirala, S. S., Mody, N. H., Huang, W. Y., Wakil, S. J. (1988). "Primary structure of the multifunctional alpha subunit protein of yeast fatty acid synthase derived from FAS2 gene sequence." J Biol Chem 263:12315-12325.2900835
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Inokoshi, J., Tomoda, H., Hashimoto, H., Watanabe, A., Takeshima, H., Omura, S. (1994). "Cerulenin-resistant mutants of Saccharomyces cerevisiae with an altered fatty acid synthase gene." Mol Gen Genet 244:90-96.8041367
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956