You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlucokinase-1
Synonyms
  • Glucose kinase 1
  • GLK-1
Gene NameGLK1
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionTwo isoenzymes, hexokinase-1 and hexokinase-2, can phosphorylate keto- and aldohexoses in yeast, whereas a third isoenzyme, GLK, is specific for aldohexoses. All glucose phosphorylating enzymes are involved in glucose uptake
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Galactose metabolismec00052 Map00052
Glycolysis / Gluconeogenesisec00010 Map00010
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Adenosine triphosphate + D-FructoseADP + Beta-D-Fructose 6-phosphate
Adenosine triphosphate + D-MannoseADP + Mannose 6-phosphate
KEGG Reactions
Adenosine triphosphate + D-GlucoseBeta-D-Glucose 6-phosphate + hydron + ADP
Adenosine triphosphate + D-Glucosealdehydo-D-glucose 6-phosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00242Mannose 6-phosphateShow
YMDB00286D-GlucoseShow
YMDB00311Beta-D-Glucose 6-phosphateShow
YMDB00582aldehydo-D-glucose 6-phosphateShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
YMDB00914ADPShow
YMDB00947Glucose 6-phosphateShow
YMDB16176Beta-D-Fructose 6-phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
hexokinase activity
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
phosphotransferase activity, alcohol group as acceptor
Process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
primary metabolic process
carbohydrate metabolic process
small molecule metabolic process
Gene Properties
Chromosome Locationchromosome 3
LocusYCL040W
Gene Sequence>1503 bp ATGTCATTCGACGACTTACACAAAGCCACTGAGAGAGCGGTCATCCAGGCCGTGGACCAG ATCTGCGACGATTTCGAGGTTACCCCCGAGAAGCTGGACGAATTAACTGCTTACTTCATC GAACAAATGGAAAAAGGTCTAGCTCCACCAAAGGAAGGCCACACATTGGCCTCGGACAAA GGTCTTCCTATGATTCCGGCGTTCGTCACCGGGTCACCCAACGGGACGGAGCGCGGTGTT TTACTAGCCGCCGACCTGGGTGGTACCAATTTCCGTATATGTTCTGTTAACTTGCATGGA GATCATACTTTCTCCATGGAGCAAATGAAGTCCAAGATTCCCGATGATTTGCTAGACGAT GAGAACGTCACATCTGACGACCTGTTTGGGTTTCTAGCACGTCGTACACTGGCCTTTATG AAGAAGTATCACCCGGACGAGTTGGCCAAGGGTAAAGACGCCAAGCCCATGAAACTGGGG TTCACTTTCTCATACCCTGTAGACCAGACCTCTCTAAACTCCGGGACATTGATCCGTTGG ACCAAGGGTTTCCGCATCGCGGACACCGTCGGAAAGGATGTCGTGCAATTGTACCAGGAG CAATTAAGCGCTCAGGGTATGCCTATGATCAAGGTTGTTGCATTAACCAACGACACCGTC GGAACGTACCTATCGCATTGCTACACGTCCGATAACACGGACTCAATGACGTCCGGAGAA ATCTCGGAGCCGGTCATCGGATGTATTTTCGGTACCGGTACCAATGGGTGCTATATGGAG GAGATCAACAAGATCACGAAGTTGCCACAGGAGTTGCGTGACAAGTTGATAAAGGAGGGT AAGACACACATGATCATCAATGTCGAATGGGGGTCCTTCGATAATGAGCTCAAGCACTTG CCTACTACTAAGTATGACGTCGTAATTGACCAGAAACTGTCAACGAACCCGGGATTTCAC TTGTTTGAAAAACGTGTCTCAGGGATGTTCTTGGGTGAGGTGTTGCGTAACATTTTAGTG GACTTGCACTCGCAAGGCTTGCTTTTGCAACAGTACAGGTCCAAGGAACAACTTCCTCGC CACTTGACTACACCTTTCCAGTTGTCATCCGAAGTGCTGTCGCATATTGAAATTGACGAC TCGACAGGTCTACGTGAAACAGAGTTGTCATTATTACAGAGTCTCAGACTGCCCACCACT CCAACAGAGCGTGTTCAAATTCAAAAATTGGTGCGCGCGATTTCTAGGAGATCTGCGTAT TTAGCCGCCGTGCCGCTTGCCGCGATATTGATCAAGACAAATGCTTTGAACAAGAGATAT CATGGTGAAGTCGAGATCGGTTGTGATGGTTCCGTTGTGGAATACTACCCCGGTTTCAGA TCTATGCTGAGACACGCCTTAGCCTTGTCACCCTTGGGTGCCGAGGGTGAGAGGAAGGTG CACTTGAAGATTGCCAAGGATGGTTCCGGAGTGGGTGCCGCCTTGTGTGCGCTTGTAGCA TGA
Protein Properties
Pfam Domain Function
Protein Residues500
Protein Molecular Weight55376.89844
Protein Theoretical pI6.13
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glucokinase-1 MSFDDLHKATERAVIQAVDQICDDFEVTPEKLDELTAYFIEQMEKGLAPPKEGHTLASDK GLPMIPAFVTGSPNGTERGVLLAADLGGTNFRICSVNLHGDHTFSMEQMKSKIPDDLLDD ENVTSDDLFGFLARRTLAFMKKYHPDELAKGKDAKPMKLGFTFSYPVDQTSLNSGTLIRW TKGFRIADTVGKDVVQLYQEQLSAQGMPMIKVVALTNDTVGTYLSHCYTSDNTDSMTSGE ISEPVIGCIFGTGTNGCYMEEINKITKLPQELRDKLIKEGKTHMIINVEWGSFDNELKHL PTTKYDVVIDQKLSTNPGFHLFEKRVSGMFLGEVLRNILVDLHSQGLLLQQYRSKEQLPR HLTTPFQLSSEVLSHIEIDDSTGLRETELSLLQSLRLPTTPTERVQIQKLVRAISRRSAY LAAVPLAAILIKTNALNKRYHGEVEIGCDGSVVEYYPGFRSMLRHALALSPLGAEGERKV HLKIAKDGSGVGAALCALVA
References
External Links
ResourceLink
Saccharomyces Genome Database GLK1
Uniprot IDP17709
Uniprot NameHXKG_YEAST
GenBank Gene IDM24077
Genebank Protein ID577521
General Reference
  • Albig, W., Entian, K. D. (1988). "Structure of yeast glucokinase, a strongly diverged specific aldo-hexose-phosphorylating isoenzyme." Gene 73:141-152.3072253
  • Scherens, B., Messenguy, F., Gigot, D., Dubois, E. (1992). "The complete sequence of a 9,543 bp segment on the left arm of chromosome III reveals five open reading frames including glucokinase and the protein disulfide isomerase." Yeast 8:577-585.1523890
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956