You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial
Synonyms
  • Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex
  • Pyruvate dehydrogenase complex component E2
  • PDC-E2
  • PDCE2
Gene NamePDA2
Enzyme Class
Biological Properties
General FunctionInvolved in acyltransferase activity
Specific FunctionThe pyruvate dehydrogenase complex catalyzes the overall conversion of pyruvate to acetyl-CoA and CO(2)
Cellular LocationMitochondrion matrix
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
TCA CyclePW002377 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Glycolysis / Gluconeogenesisec00010 Map00010
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Oxoglutaric acid + NAD + Coenzyme ASuccinyl-CoA + NADH + hydron + Carbon dioxide
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00153Oxoglutaric acidShow
YMDB00312Acetyl-CoAShow
YMDB00514Succinyl-CoAShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
macromolecular complex
protein complex
pyruvate dehydrogenase complex
Function
catalytic activity
transferase activity
acetyltransferase activity
binding
transferase activity, transferring acyl groups
S-acetyltransferase activity
transferase activity, transferring acyl groups other than amino-acyl groups
dihydrolipoyllysine-residue acetyltransferase activity
acyltransferase activity
protein binding
Process
organic acid metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
metabolic process
cellular metabolic process
monocarboxylic acid metabolic process
pyruvate metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYNL071W
Gene Sequence>1449 bp ATGTCTGCCTTTGTCAGGGTGGTTCCAAGAATATCCAGAAGTTCAGTACTCACCAGATCA TTGAGACTGCAATTGAGATGCTACGCATCGTACCCAGAGCACACCATTATTGGTATGCCG GCACTGTCTCCTACGATGACGCAAGGTAATCTTGCTGCTTGGACTAAGAAGGAAGGTGAC CAATTGTCTCCCGGTGAAGTTATTGCCGAAATAGAAACAGACAAGGCTCAAATGGACTTT GAGTTCCAAGAAGATGGTTACTTAGCCAAGATTCTAGTTCCTGAAGGTACAAAGGACATT CCTGTCAACAAGCCTATTGCCGTCTATGTGGAGGACAAAGCTGATGTGCCAGCTTTTAAG GACTTTAAGCTGGAGGATTCAGGTTCTGATTCAAAGACCAGTACGAAGGCTCAGCCTGCC GAACCACAGGCAGAAAAGAAACAAGAAGCGCCAGCTGAAGAGACCAAGACTTCTGCACCT GAAGCTAAGAAATCTGACGTTGCTGCTCCTCAAGGTAGGATTTTTGCCTCTCCACTTGCC AAGACTATCGCCTTGGAAAAGGGTATTTCTTTGAAGGATGTTCACGGCACTGGACCCCGC GGTAGAATTACCAAGGCTGACATTGAGTCATATCTAGAAAAGTCGTCTAAGCAGTCTTCT CAAACCAGTGGTGCTGCCGCCGCCACTCCTGCCGCCGCTACCTCAAGCACTACTGCTGGC TCTGCTCCATCGCCTTCTTCTACAGCATCATATGAGGATGTTCCAATTTCAACCATGAGA AGCATCATTGGAGAACGTTTATTGCAATCTACTCAAGGCATTCCATCATACATCGTTTCC TCCAAGATATCCATCTCCAAACTTTTGAAATTGAGACAGTCCTTGAACGCTACAGCAAAC GACAAGTACAAACTGTCCATTAATGACCTATTAGTAAAAGCCATCACTGTTGCGGCTAAG AGGGTGCCAGATGCCAATGCCTACTGGTTACCTAATGAGAACGTTATCCGTAAATTCAAG AATGTCGATGTCTCAGTCGCTGTTGCCACACCAACAGGATTATTGACACCAATTGTCAAG AATTGTGAGGCCAAGGGCTTGTCGCAAATCTCTAACGAAATCAAGGAACTAGTCAAGCGT GCCAGAATAAACAAATTGGCACCAGAGGAATTCCAAGGTGGGACCATTTGCATATCCAAT ATGGGCATGAATAATGCTGTTAACATGTTTACTTCGATTATCAACCCACCACAGTCTACA ATCTTGGCCATCGCTACTGTTGAAAGGGTCGCTGTGGAAGACGCCGCTGCTGAGAACGGA TTCTCCTTTGATAACCAGGTTACCATAACAGGGACCTTTGATCATAGAACCATTGATGGC GCCAAAGGTGCAGAATTCATGAAGGAATTGAAAACTGTTATTGAAAATCCTTTGGAAATG CTATTGTGA
Protein Properties
Pfam Domain Function
Protein Residues482
Protein Molecular Weight51817.5
Protein Theoretical pI8.02
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Dihydrolipoyllysine-residue acetyltransferase component of pyruvate dehydrogenase complex, mitochondrial MSAFVRVVPRISRSSVLTRSLRLQLRCYASYPEHTIIGMPALSPTMTQGNLAAWTKKEGD QLSPGEVIAEIETDKAQMDFEFQEDGYLAKILVPEGTKDIPVNKPIAVYVEDKADVPAFK DFKLEDSGSDSKTSTKAQPAEPQAEKKQEAPAEETKTSAPEAKKSDVAAPQGRIFASPLA KTIALEKGISLKDVHGTGPRGRITKADIESYLEKSSKQSSQTSGAAAATPAAATSSTTAG SAPSPSSTASYEDVPISTMRSIIGERLLQSTQGIPSYIVSSKISISKLLKLRQSLNATAN DKYKLSINDLLVKAITVAAKRVPDANAYWLPNENVIRKFKNVDVSVAVATPTGLLTPIVK NCEAKGLSQISNEIKELVKRARINKLAPEEFQGGTICISNMGMNNAVNMFTSIINPPQST ILAIATVERVAVEDAAAENGFSFDNQVTITGTFDHRTIDGAKGAEFMKELKTVIENPLEM LL
References
External Links
ResourceLink
Saccharomyces Genome Database PDA2
Uniprot IDP12695
Uniprot NameODP2_YEAST
GenBank Gene IDAY693185
Genebank Protein ID51013821
General Reference
  • Niu, X. D., Browning, K. S., Behal, R. H., Reed, L. J. (1988). "Cloning and nucleotide sequence of the gene for dihydrolipoamide acetyltransferase from Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 85:7546-7550.3050999
  • Pohlmann, R., Philippsen, P. (1996). "Sequencing a cosmid clone of Saccharomyces cerevisiae chromosome XIV reveals 12 new open reading frames (ORFs) and an ancient duplication of six ORFs." Yeast 12:391-402.8701611
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956