You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCoproporphyrinogen-III oxidase
Synonyms
  • COX
  • Coprogen oxidase
  • Coproporphyrinogenase
Gene NameHEM13
Enzyme Class
Biological Properties
General FunctionInvolved in coproporphyrinogen oxidase activity
Specific FunctionKey enzyme in heme biosynthesis. Catalyzes the oxidative decarboxylation of propionic acid side chains of rings A and B of coproporphyrinogen III
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Porphyrin and chlorophyll metabolismec00860 Map00860
SMPDB ReactionsNot Available
KEGG Reactions
Coproporphyrinogen III + oxygen + hydronwater + Carbon dioxide + Protoporphyrinogen IX
Metabolites
YMDB IDNameView
YMDB00084Coproporphyrinogen IIIShow
YMDB00156Protoporphyrinogen IXShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00888Hydrogen peroxideShow
YMDB00890waterShow
YMDB00900oxygenShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on the CH-CH group of donors
coproporphyrinogen oxidase activity
catalytic activity
oxidoreductase activity
oxidoreductase activity, acting on the CH-CH group of donors, oxygen as acceptor
Process
metabolic process
nitrogen compound metabolic process
oxidation reduction
tetrapyrrole metabolic process
porphyrin metabolic process
porphyrin biosynthetic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR044W
Gene Sequence>987 bp ATGCCTGCCCCTCAAGATCCAAGGAATCTTCCAATTAGACAACAAATGGAAGCCCTTATC CGTCGCAAACAAGCTGAAATCACGCAAGGTTTGGAATCCATCGATACTGTTAAGTTCCAC GCTGATACTTGGACCCGTGGTAACGATGGTGGTGGTGGTACCTCTATGGTTATCCAAGAC GGTACAACTTTCGAAAAAGGTGGTGTTAATGTCTCCGTTGTTTATGGTCAATTGAGCCCA GCGGCCGTTTCAGCCATGAAAGCTGATCATAAGAATCTGCGTCTACCAGAAGATCCAAAG ACTGGTTTGCCAGTTACCGACGGTGTCAAGTTCTTCGCTTGTGGTTTAAGTATGGTCATT CATCCCGTTAACCCACACGCTCCAACCACGCACTTAAACTACCGTTACTTCGAAACTTGG AACCAAGATGGGACCCCACAAACTTGGTGGTTTGGTGGTGGTGCTGATTTGACACCTTCT TACTTATACGAAGAAGACGGTCAATTATTCCACCAACTGCACAAGGATGCCTTGGACAAG CACGACACTGCTTTGTACCCACGTTTCAAGAAATGGTGTGATGAGTACTTCTACATTACC CACCGTAAGGAAACACGTGGTATTGGTGGTATATTCTTTGACGATTATGATGAACGTGAC CCACAAGAAATATTGAAGATGGTTGAAGACTGTTTCGATGCTTTCTTGCCATCCTACTTG ACTATCGTCAAGAGAAGAAAAGATATGCCATATACAAAGGAAGAACAACAATGGCAGGCC ATTAGACGTGGTAGATACGTTGAATTCAACTTAATCTACGATAGAGGTACCCAATTCGGT TTGAGAACCCCAGGCTCTAGAGTTGAGTCAATTTTGATGAGTTTGCCTGAACATGCTTCA TGGTTATACAACCACCACCCTGCTCCTGGTTCCAGAGAAGCTAAATTACTAGAAGTTACC ACCAAACCAAGAGAGTGGGTTAAATAA
Protein Properties
Pfam Domain Function
Protein Residues328
Protein Molecular Weight37711.30078
Protein Theoretical pI6.8
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Coproporphyrinogen-III oxidase MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS WLYNHHPAPGSREAKLLEVTTKPREWVK
References
External Links
ResourceLink
Saccharomyces Genome Database HEM13
Uniprot IDP11353
Uniprot NameHEM6_YEAST
GenBank Gene IDAY557656
Genebank Protein ID45269205
PDB ID
1TLB
General Reference
  • Zagorec, M., Buhler, J. M., Treich, I., Keng, T., Guarente, L., Labbe-Bois, R. (1988). "Isolation, sequence, and regulation by oxygen of the yeast HEM13 gene coding for coproporphyrinogen oxidase." J Biol Chem 263:9718-9724.2838478
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Camadro, J. M., Chambon, H., Jolles, J., Labbe, P. (1986). "Purification and properties of coproporphyrinogen oxidase from the yeast Saccharomyces cerevisiae." Eur J Biochem 156:579-587.3516695
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Phillips, J. D., Whitby, F. G., Warby, C. A., Labbe, P., Yang, C., Pflugrath, J. W., Ferrara, J. D., Robinson, H., Kushner, J. P., Hill, C. P. (2004). "Crystal structure of the oxygen-dependant coproporphyrinogen oxidase (Hem13p) of Saccharomyces cerevisiae." J Biol Chem 279:38960-38968.15194705