You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCoproporphyrinogen-III oxidase
Synonyms
  • COX
  • Coprogen oxidase
  • Coproporphyrinogenase
Gene NameHEM13
Enzyme Class
Biological Properties
General FunctionInvolved in coproporphyrinogen oxidase activity
Specific FunctionKey enzyme in heme biosynthesis. Catalyzes the oxidative decarboxylation of propionic acid side chains of rings A and B of coproporphyrinogen III
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Porphyrin and chlorophyll metabolismec00860 Map00860
SMPDB ReactionsNot Available
KEGG Reactions
Coproporphyrinogen III + oxygen + hydronwater + Carbon dioxide + Protoporphyrinogen IX
Metabolites
YMDB IDNameView
YMDB00084Coproporphyrinogen IIIShow
YMDB00156Protoporphyrinogen IXShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00888Hydrogen peroxideShow
YMDB00890waterShow
YMDB00900oxygenShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
oxidoreductase activity, acting on the CH-CH group of donors, oxygen as acceptor
oxidoreductase activity, acting on the CH-CH group of donors
coproporphyrinogen oxidase activity
catalytic activity
oxidoreductase activity
Process
tetrapyrrole metabolic process
porphyrin metabolic process
porphyrin biosynthetic process
metabolic process
nitrogen compound metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 4
LocusYDR044W
Gene Sequence>987 bp ATGCCTGCCCCTCAAGATCCAAGGAATCTTCCAATTAGACAACAAATGGAAGCCCTTATC CGTCGCAAACAAGCTGAAATCACGCAAGGTTTGGAATCCATCGATACTGTTAAGTTCCAC GCTGATACTTGGACCCGTGGTAACGATGGTGGTGGTGGTACCTCTATGGTTATCCAAGAC GGTACAACTTTCGAAAAAGGTGGTGTTAATGTCTCCGTTGTTTATGGTCAATTGAGCCCA GCGGCCGTTTCAGCCATGAAAGCTGATCATAAGAATCTGCGTCTACCAGAAGATCCAAAG ACTGGTTTGCCAGTTACCGACGGTGTCAAGTTCTTCGCTTGTGGTTTAAGTATGGTCATT CATCCCGTTAACCCACACGCTCCAACCACGCACTTAAACTACCGTTACTTCGAAACTTGG AACCAAGATGGGACCCCACAAACTTGGTGGTTTGGTGGTGGTGCTGATTTGACACCTTCT TACTTATACGAAGAAGACGGTCAATTATTCCACCAACTGCACAAGGATGCCTTGGACAAG CACGACACTGCTTTGTACCCACGTTTCAAGAAATGGTGTGATGAGTACTTCTACATTACC CACCGTAAGGAAACACGTGGTATTGGTGGTATATTCTTTGACGATTATGATGAACGTGAC CCACAAGAAATATTGAAGATGGTTGAAGACTGTTTCGATGCTTTCTTGCCATCCTACTTG ACTATCGTCAAGAGAAGAAAAGATATGCCATATACAAAGGAAGAACAACAATGGCAGGCC ATTAGACGTGGTAGATACGTTGAATTCAACTTAATCTACGATAGAGGTACCCAATTCGGT TTGAGAACCCCAGGCTCTAGAGTTGAGTCAATTTTGATGAGTTTGCCTGAACATGCTTCA TGGTTATACAACCACCACCCTGCTCCTGGTTCCAGAGAAGCTAAATTACTAGAAGTTACC ACCAAACCAAGAGAGTGGGTTAAATAA
Protein Properties
Pfam Domain Function
Protein Residues328
Protein Molecular Weight37711.30078
Protein Theoretical pI6.8
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Coproporphyrinogen-III oxidase MPAPQDPRNLPIRQQMEALIRRKQAEITQGLESIDTVKFHADTWTRGNDGGGGTSMVIQD GTTFEKGGVNVSVVYGQLSPAAVSAMKADHKNLRLPEDPKTGLPVTDGVKFFACGLSMVI HPVNPHAPTTHLNYRYFETWNQDGTPQTWWFGGGADLTPSYLYEEDGQLFHQLHKDALDK HDTALYPRFKKWCDEYFYITHRKETRGIGGIFFDDYDERDPQEILKMVEDCFDAFLPSYL TIVKRRKDMPYTKEEQQWQAIRRGRYVEFNLIYDRGTQFGLRTPGSRVESILMSLPEHAS WLYNHHPAPGSREAKLLEVTTKPREWVK
References
External Links
ResourceLink
Saccharomyces Genome Database HEM13
Uniprot IDP11353
Uniprot NameHEM6_YEAST
GenBank Gene IDAY557656
Genebank Protein ID45269205
PDB ID
1TLB
General Reference
  • Zagorec, M., Buhler, J. M., Treich, I., Keng, T., Guarente, L., Labbe-Bois, R. (1988). "Isolation, sequence, and regulation by oxygen of the yeast HEM13 gene coding for coproporphyrinogen oxidase." J Biol Chem 263:9718-9724.2838478
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Camadro, J. M., Chambon, H., Jolles, J., Labbe, P. (1986). "Purification and properties of coproporphyrinogen oxidase from the yeast Saccharomyces cerevisiae." Eur J Biochem 156:579-587.3516695
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Phillips, J. D., Whitby, F. G., Warby, C. A., Labbe, P., Yang, C., Pflugrath, J. W., Ferrara, J. D., Robinson, H., Kushner, J. P., Hill, C. P. (2004). "Crystal structure of the oxygen-dependant coproporphyrinogen oxidase (Hem13p) of Saccharomyces cerevisiae." J Biol Chem 279:38960-38968.15194705