You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameS-adenosylmethionine synthase 1
Synonyms
  • AdoMet synthase 1
  • Methionine adenosyltransferase 1
  • MAT 1
Gene NameSAM1
Enzyme Class
Biological Properties
General FunctionInvolved in methionine adenosyltransferase activity
Specific FunctionCatalyzes the formation of S-adenosylmethionine from methionine and ATP
Cellular LocationNot Available
SMPDB Pathways
Methionine metabolism and salvagePW002384 ThumbThumb?image type=greyscaleThumb?image type=simple
Selenocompound metabolismPW002472 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
Selenocompound metabolismec00450 Map00450
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
L-Methionine + Adenosine triphosphate + waterphosphate + Pyrophosphate + S-Adenosyl-L-methionine
KEGG Reactions
L-Methionine + Adenosine triphosphate + waterPyrophosphate + phosphate + S-Adenosylmethionine
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00297S-AdenosylmethionineShow
YMDB00318L-MethionineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
transferase activity, transferring alkyl or aryl (other than methyl) groups
methionine adenosyltransferase activity
catalytic activity
transferase activity
binding
Process
one-carbon metabolic process
metabolic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR180W
Gene Sequence>1149 bp ATGGCCGGTACATTTTTATTCACTTCTGAATCCGTTGGTGAAGGTCACCCAGATAAGATC TGTGACCAAGTTTCCGACGCCATCTTGGACGCTTGTTTAGCCGAGGACCCTCACTCCAAA GTTGCGTGTGAAACCGCGGCAAAGACTGGTATGATTATGGTCTTTGGTGAAATTACTACC AAGGCACAGTTGGATTACCAAAAAATCGTCAGAGACACCATCAAGAAGATTGGTTACGAT GATTCCGCCAAGGGTTTCGACTATAAGACCTGTAACGTCCTTGTCGCCATTGAGCAACAA TCTCCAGATATCGCCCAAGGTGTCCACGAGGAGAAGGATTTGGAAGACATCGGTGCCGGT GACCAAGGTATCATGTTTGGTTACGCCACAGATGAAACTCCAGAGGGTTTGCCTTTGACT ATTCTTTTGGCTCATAAACTAAACATGGCCATGGCTGACGCGAGAAGAGATGGCTCTTTA GCGTGGTTGAGACCAGACACCAAGACTCAAGTCACCGTCGAATACAAGGATGACCACGGT AGATGGGTTCCACAAAGAATCGACACCGTCGTCGTCTCCGCTCAACATGCTGACGAAATC ACGACCGAGGACTTAAGAGCGCAACTAAAGTCCGAGATCATTGAAAAAGTCATCCCAAGA GACATGTTGGACGAAAACACCAAATACTTTATCCAACCTTCCGGTAGATTCGTCATCGGT GGTCCTCAAGGTGACACTGGTTTGACCGGTAGAAAGATCATCGTCGACGCTTACGGTGGT GCCTCATCCGTCGGTGGTGGTGCCTTCTCCGGTAAGGACTACTCTAAGGTTGATCGTTCT GCCGCTTATGCCGCTAGATGGGTTGCCAAGTCCCTAGTTGCCGCTGGTTTATGTAAGAGA GTTCAAGTTCAATTTTCTTATGCCATCGGTATTGCGGAACCATTGTCCTTGCACGTTGAC ACCTATGGTACTGCGACCAAGTCTGACGAAGAAATTATCGACATTATCAGCAAGAACTTT GACTTGAGACCTGGTGTATTGGTCAAGGAGTTGGACTTAGCTAGACCATTCTACTTGCCA ACCGCTTCTTATGGCCATTTCACAAACCAAGAATACCCATGGGAAAAGCCTAAGACTTTG AAGTTCTAA
Protein Properties
Pfam Domain Function
Protein Residues382
Protein Molecular Weight41818.0
Protein Theoretical pI4.83
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>S-adenosylmethionine synthase 1 MAGTFLFTSESVGEGHPDKICDQVSDAILDACLAEDPHSKVACETAAKTGMIMVFGEITT KAQLDYQKIVRDTIKKIGYDDSAKGFDYKTCNVLVAIEQQSPDIAQGVHEEKDLEDIGAG DQGIMFGYATDETPEGLPLTILLAHKLNMAMADARRDGSLAWLRPDTKTQVTVEYKDDHG RWVPQRIDTVVVSAQHADEITTEDLRAQLKSEIIEKVIPRDMLDENTKYFIQPSGRFVIG GPQGDAGLTGRKIIVDAYGGASSVGGGAFSGKDYSKVDRSAAYAARWVAKSLVAAGLCKR VQVQFSYAIGIAEPLSLHVDTYGTATKSDEEIIDIISKNFDLRPGVLVKELDLARPIYLP TASYGHFTNQEYPWEKPKTLKF
References
External Links
ResourceLink
Saccharomyces Genome Database SAM1
Uniprot IDP10659
Uniprot NameMETK1_YEAST
GenBank Gene IDJ03477
Genebank Protein ID172534
General Reference
  • Thomas, D., Surdin-Kerjan, Y. (1987). "SAM1, the structural gene for one of the S-adenosylmethionine synthetases in Saccharomyces cerevisiae. Sequence and expression." J Biol Chem 262:16704-16709.3316224
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Norbeck, J., Blomberg, A. (1996). "Protein expression during exponential growth in 0.7 M NaCl medium of Saccharomyces cerevisiae." FEMS Microbiol Lett 137:1-8.8935650
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106