You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameC-1-tetrahydrofolate synthase, mitochondrial
Synonyms
  • C1-THF synthase
  • Methylenetetrahydrofolate dehydrogenase
  • Methenyltetrahydrofolate cyclohydrolase
  • Formyltetrahydrofolate synthetase
Gene NameMIS1
Enzyme Class
Biological Properties
General FunctionInvolved in formate-tetrahydrofolate ligase activity
Specific Function5,10-methylenetetrahydrofolate + NADP(+) = 5,10-methenyltetrahydrofolate + NADPH
Cellular LocationMitochondrion
SMPDB Pathways
glycine metabolismPW002398 ThumbThumb?image type=greyscaleThumb?image type=simple
serine metabolismPW002402 ThumbThumb?image type=greyscaleThumb?image type=simple
tetrahydrofolate biosynthesisPW002417 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glyoxylate and dicarboxylate metabolismec00630 Map00630
One carbon pool by folateec00670 Map00670
SMPDB Reactions
5,10-Methylene-THF + NADP5,10-Methenyltetrahydrofolic acid + NADPH
5,10-Methenyltetrahydrofolic acid + waterN10-Formyl-THF + hydron
N10-Formyl-THF + ADP + phosphateAdenosine triphosphate + Formic acid + Tetrahydrofolic acid
KEGG Reactions
Adenosine triphosphate + 5,6,7,8-Tetrahydrofolic acid + Formic acidN10-Formyl-THF + phosphate + ADP
(6R)-5,10-Methenyltetrahydrofolic acid + waterN10-Formyl-THF + hydron
NADP + 5,10-Methylene-THF(6R)-5,10-Methenyltetrahydrofolic acid + NADPH
Metabolites
YMDB IDNameView
YMDB00080N10-Formyl-THFShow
YMDB00109Adenosine triphosphateShow
YMDB00139Tetrahydrofolic acidShow
YMDB001765,10-Methenyltetrahydrofolic acidShow
YMDB002605,10-Methylene-THFShow
YMDB00385Formic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB004835,6,7,8-Tetrahydrofolic acidShow
YMDB00515(6R)-5,10-Methenyltetrahydrofolic acidShow
YMDB0051710-Formyltetrahydrofolic acidShow
YMDB00848(6R)-5,10-methylenetetrahydrofolic acidShow
YMDB00862hydronShow
YMDB008795,10-MethenyltetrahydrofolateShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
adenyl nucleotide binding
adenyl ribonucleotide binding
catalytic activity
ATP binding
ligase activity
ligase activity, forming carbon-nitrogen bonds
formate-tetrahydrofolate ligase activity
binding
nucleoside binding
purine nucleoside binding
Process
metabolic process
cellular aromatic compound metabolic process
folic acid and derivative metabolic process
folic acid and derivative biosynthetic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR084W
Gene Sequence>2928 bp ATGTTGTCGAGACTATCTTTATTGAGTAACTCGAGGGCGTTCCAACAGGCCAGATGGCGC ATTTACCGCTTAAAAGTTTCGCCAACTGTGCATGCTTCTCAATACCATATTCTTTCTGGT AGGAAACTTGCTCAATCTATTCGAGAAAAAGCCAATGATGAGATACAAGCCATTAAGCTT AAGCATCCTAATTTCAAGCCTACCTTGAAAATCATTCAAGTCGGGGCCAGACCAGACTCA TCTACGTACGTGAGGATGAAATTGAAAGCTTCAAAGGACAGCAATGTAGACTGTATCATA GAGAAGTTACCAGCAGAAATCACTGAAGTTGAGCTTTTGAAGAAAATTAGTGACATCAAT GATGATGACTCTATCCATGGGTTGCTAATTCAACTACCTCTACCGCGTCACTTGGATGAA ACCACGATTACAAACGCTGTGGACTTTAAAAAGGACGTTGATGGGTTCCACAGATATAAT GCTGGTGAATTGGCTAAAAAAGGAGGGAAACCATACTTCATACCATGTACTCCTTATGGT TGCATGAAATTACTTGAAGAAGCTCATGTTAAGTTAGATGGTAAGAACGCCGTCGTGTTA GGCAGATCAAGTATCGTCGGAAATCCAATTGCTTCGTTGTTGAAAAATGCGAATGCCACT GTTACTGTCTGTCATAGTCATACAAGGAACATTGCAGAAGTGGTCTCCCAAGCTGATATA GTTATCGCAGCTTGCGGTATTCCTCAATACGTTAAATCAGACTGGATTAAAGAAGGCGCC GTGGTTATTGATGTAGGTATCAACTACGTACCTGATATCAGTAAGAAAAGTGGGCAAAAA TTAGTTGGTGATGTTGATTTTGATTCTGTAAAGGAAAAGACATCTTATATTACCCCTGTT CCTGGTGGAGTGGGTCCAATGACTGTCGCTATGCTTGTTTCCAATGTACTATTAGCTGCT AAAAGGCAATTCGTGGAATCTGAAAAGCTTCCAGTTATCAAACCTCTTCCATTACACTTA GAAAGTCCAGTGCCTTCAGATATTGATATATCAAGAGCTCAGAGTCCTAAGCATATCAAG CAAGTTGCCGAGGAGTTGGGAATCCACTCTCACGAATTAGAATTATACGGCCACTATAAG GCAAAAATTTCTCCAAATATTTTTAAAAGATTAGAATCTAGAGAAAACGGTAAGTACGTC CTTGTTGCAGGTATTACTCCGACTCCATTGGGTGAAGGTAAATCCACTACGACTATGGGG TTGGTGCAGGCTTTATCCGCTCATTTAGGGAAACCATCCATCGCGAACGTTAGACAACCA TCTCTTGGCCCAACCCTGGGTGTCAAAGGTGGTGCTGCTGGTGGTGGTTATGCCCAAGTT ATTCCTATGGACGAGTTCAATTTACATTTGACCGGGGATATTCATGCTATCAGCGCTGCG AACAATCTTCTTGCAGCAGCTATCGACACTAGAATGTTCCATGAAGCCACTCAGAAGAAT GATAGTACATTTTACAAGAGACTAGTTCCAAGAAAAAAAGGCATCAGAAAGTTTACCCCA TCCATGCAGAGAAGGCTTAAAAGATTGGATATTGAAAAAGAAGACCCTGATGCTTTAACA CCTGAAGAAGTCAAAAGATTTGCTAGATTGAACATAAATCCCGATACTATCACTATCAGA AGAGTTGTCGACATCAATGACAGGATGTTAAGACAAATTACCATTGGCGAAGCCGCTACG GAGAAGGGTTTTACAAGGACCACTGGATTCGATATCACTGTTGCCTCTGAATTAATGGCC ATTTTAGCTCTATCTAAAAGCTTACACGAGATGAAGGAACGTATTGGACGCATGGTTATT GGTGCTGATTATGATAACAAACCAGTAACAGTAGAAGATATTGGCTGTACCGGTGCTCTG ACTGCATTATTACGTGACGCTATAAAGCCTAACTTAATGCAAACTTTGGAAGGGACCCCC GTAATGGTTCACGCTGGTCCTTTCGCCAACATCTCCATCGGCGCATCATCAGTAATTGCA GACTTAATGGCATTGAAGCTTGTTGGTTCAGAAAAGAACCCGTTAAATGACAAGAACATC CATGAACCTGGTTATGTAGTTACTGAAGCAGGATTCGATTTTGCCATGGGTGGTGAAAGA TTCTTTGATATCAAATGTCGTTCCTCTGGATTGGTGCCAGATGCAGTTGTCTTAGTCGCA ACCGTAAGAGCTTTGAAATCTCATGGAGGTGCTCCAAATGTTAAGCCCGGACAATCATTA CCAAAAGAATACACAGAGGAAAACATCGATTTTGTTGCCAAGGGTGTTAGTAATTTGGTT AAGCAGATTGAAAACATCAAAACGTTTGGAATACCAGTCGTTGTAGCAATCAACAGATTT GAAACAGACTCACAGGCAGAGATTGAGGTAATCAAGAAAGCAGCCTTGAATGCTGGCGCA TCTCATGCCGTTACTTCTAATCACTGGATGGAAGGTGGTAAAGGTGCAGTAGAATTAGCA CATGCTGTGGTAGATGCAACGAAAGAACCAAAGAACTTTAACTTTTTGTACGACGTCAAT AGCTCCATCGAGGACAAGCTTACCAGCATCGTCCAAAAAATGTATGGTGGGGCAAAAATC GAAGTATCACCAGAAGCCCAAAAAAAGATAGACACCTACAAAAAACAAGGCTTCGGTAAT CTTCCCATCTGTATTGCTAAGACACAATATTCATTATCCCATGATCCATCATTAAAGGGT GTTCCTAGAGGTTTTACGTTCCCCATCAGGGATGTGAGAGCTTCAATAGGTGCAGGTTAT TTATACGCTTTGGCTGCAGAAATTCAAACCATACCGGGTCTATCGACATATGCTGGTTAC ATGGCAGTAGAAGTCGACGACGACGGTGAAATTGAAGGTCTATTTTAA
Protein Properties
Pfam Domain Function
Protein Residues975
Protein Molecular Weight106216.0
Protein Theoretical pI9.02
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>C-1-tetrahydrofolate synthase, mitochondrial MLSRLSLLSNSRAFQQARWRIYRLKVSPTVHASQYHILSGRKLAQSIREKANDEIQAIKL KHPNFKPTLKIIQVGARPDSSTYVRMKLKASKDSNVDCIIEKLPAEITEVELLKKISDIN DDDSIHGLLIQLPLPRHLDETTITNAVDFKKDVDGFHRYNAGELAKKGGKPYFIPCTPYG CMKLLEEAHVKLDGKNAVVLGRSSIVGNPIASLLKNANATVTVCHSHTRNIAEVVSQADI VIAACGIPQYVKSDWIKEGAVVIDVGINYVPDISKKSGQKLVGDVDFDSVKEKTSYITPV PGGVGPMTVAMLVSNVLLAAKRQFVESEKLPVIKPLPLHLESPVPSDIDISRAQSPKHIK QVAEELGIHSHELELYGHYKAKISPNIFKRLESRENGKYVLVAGITPTPLGEGKSTTTMG LVQALSAHLGKPSIANVRQPSLGPTLGVKGGAAGGGYAQVIPMDEFNLHLTGDIHAISAA NNLLAAAIDTRMFHEATQKNDSTFYKRLVPRKKGIRKFTPSMQRRLKRLDIEKEDPDALT PEEVKRFARLNINPDTITIRRVVDINDRMLRQITIGEAATEKGFTRTTGFDITVASELMA ILALSKSLHEMKERIGRMVIGADYDNKPVTVEDIGCTGALTALLRDAIKPNLMQTLEGTP VMVHAGPFANISIGASSVIADLMALKLVGSEKNPLNDKNIHEPGYVVTEAGFDFAMGGER FFDIKCRSSGLVPDAVVLVATVRALKSHGGAPNVKPGQSLPKEYTEENIDFVAKGVSNLV KQIENIKTFGIPVVVAINRFETDSQAEIEVIKKAALNAGASHAVTSNHWMEGGKGAVELA HAVVDATKEPKNFNFLYDVNSSIEDKLTSIVQKMYGGAKIEVSPEAQKKIDTYKKQGFGN LPICIAKTQYSLSHDPSLKGVPRGFTFPIRDVRASIGAGYLYALAAEIQTIPGLSTYAGY MAVEVDDDGEIEGLF
References
External Links
ResourceLink
Saccharomyces Genome Database MIS1
Uniprot IDP09440
Uniprot NameC1TM_YEAST
GenBank Gene IDJ03724
Genebank Protein ID171953
General Reference
  • Shannon, K. W., Rabinowitz, J. C. (1988). "Isolation and characterization of the Saccharomyces cerevisiae MIS1 gene encoding mitochondrial C1-tetrahydrofolate synthase." J Biol Chem 263:7717-7725.2836393
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Shannon, K. W., Rabinowitz, J. C. (1986). "Purification and characterization of a mitochondrial isozyme of C1-tetrahydrofolate synthase from Saccharomyces cerevisiae." J Biol Chem 261:12266-12271.3528153
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Sickmann, A., Reinders, J., Wagner, Y., Joppich, C., Zahedi, R., Meyer, H. E., Schonfisch, B., Perschil, I., Chacinska, A., Guiard, B., Rehling, P., Pfanner, N., Meisinger, C. (2003). "The proteome of Saccharomyces cerevisiae mitochondria." Proc Natl Acad Sci U S A 100:13207-13212.14576278
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956