You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCitrate synthase, peroxisomal
SynonymsNot Available
Gene NameCIT2
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
Specific FunctionAcetyl-CoA + H(2)O + oxaloacetate = citrate + CoA
Cellular LocationPeroxisome
SMPDB Pathways
Glyoxylate cyclePW002419 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Glyoxylate and dicarboxylate metabolismec00630 Map00630
SMPDB Reactions
Oxalacetic acid + Acetyl-CoA + waterCoenzyme A + hydron + Citric acid
KEGG Reactions
Acetyl-CoA + water + Oxalacetic acidhydron + Citric acid + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00086Citric acidShow
YMDB00235Oxalacetic acidShow
YMDB00312Acetyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
citrate (Si)-synthase activity
transferase activity, transferring acyl groups
catalytic activity
transferase activity
transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
Process
cellular carbohydrate metabolic process
cellular metabolic process
primary metabolic process
carbohydrate metabolic process
cofactor metabolic process
coenzyme metabolic process
acetyl-CoA metabolic process
acetyl-CoA catabolic process
tricarboxylic acid cycle
metabolic process
Gene Properties
Chromosome Locationchromosome 3
LocusYCR005C
Gene Sequence>1383 bp ATGACAGTTCCTTATCTAAATTCAAACAGAAATGTTGCATCATATTTACAATCAAATTCA AGCCAAGAAAAGACTCTAAAAGAGAGATTTAGCGAAATCTACCCCATCCATGCTCAAGAT GTAAGGCAATTCGTTAAAGAGCATGGCAAAACTAAAATTAGCGATGTTCTATTAGAACAG GTATATGGTGGTATGAGAGGTATTCCAGGGAGCGTATGGGAAGGTTCCGTTTTGGACCCA GAAGACGGTATTCGTTTCAGAGGTCGTACGATCGCCGACATTCAAAAGGACCTGCCCAAG GCAAAAGGAAGCTCACAACCACTACCAGAAGCTCTCTTTTGGTTATTGCTAACTGGCGAG GTTCCAACTCAAGCGCAAGTTGAAAACTTATCAGCTGATCTAATGTCAAGATCGGAACTA CCTAGTCATGTCGTTCAACTTTTGGATAATTTACCAAAGGACTTACACCCAATGGCTCAA TTCTCTATTGCTGTAACTGCCTTGGAAAGCGAGTCAAAGTTTGCTAAGGCTTATGCTCAA GGAATTTCCAAGCAGGATTATTGGAGTTATACTTTTGAAGATTCACTAGACTTGCTGGGT AAATTGCCAGTTATTGCAGCTAAAATTTATCGTAATGTATTCAAAGATGGCAAAATGGGT GAAGTGGACCCAAATGCCGATTATGCTAAAAATCTGGTCAACTTGATTGGTTCTAAGGAT GAAGATTTCGTGGACTTGATGAGACTTTATTTAACCATTCATTCGGATCACGAAGGTGGT AATGTATCTGCACATACATCCCATCTTGTGGGCTCAGCACTATCATCACCTTATCTGTCC CTTGCATCAGGTTTGAACGGGTTGGCTGGCCCACTTCATGGGCGTGCTAATCAAGAAGTA CTAGAATGGTTATTTGCACTTAAAGAAGAGGTAAATGATGACTACTCTAAAGATACGATC GAAAAATATTTATGGGATACTCTAAACTCAGGGAGAGTCATTCCCGGTTATGGTCATGCT GTGCTAAGGAAAACTGATCCTCGTTATATGGCTCAGCGTAAGTTTGCCATGGACCATTTT CCAGATTATGAATTATTCAAGTTAGTTTCATCAATATACGAGGTAGCACCTGGCGTATTG ACTGAACATGGTAAAACCAAAAATCCATGGCCAAATGTAGATGCTCACTCTGGTGTCTTA TTACAATATTATGGACTAAAAGAATCTTCTTTCTATACCGTTTTATTTGGCGTTTCAAGG GCATTTGGTATTCTTGCTCAATTGATCACTGATAGGGCCATCGGTGCTTCCATTGAAAGG CCAAAGTCCTATTCTACTGAGAAATACAAGGAATTGGTCAAAAACATTGAAAGCAAACTA TAG
Protein Properties
Pfam Domain Function
Protein Residues460
Protein Molecular Weight51412.89844
Protein Theoretical pI6.33
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Citrate synthase, peroxisomal MTVPYLNSNRNVASYLQSNSSQEKTLKERFSEIYPIHAQDVRQFVKEHGKTKISDVLLEQ VYGGMRGIPGSVWEGSVLDPEDGIRFRGRTIADIQKDLPKAKGSSQPLPEALFWLLLTGE VPTQAQVENLSADLMSRSELPSHVVQLLDNLPKDLHPMAQFSIAVTALESESKFAKAYAQ GISKQDYWSYTFEDSLDLLGKLPVIAAKIYRNVFKDGKMGEVDPNADYAKNLVNLIGSKD EDFVDLMRLYLTIHSDHEGGNVSAHTSHLVGSALSSPYLSLASGLNGLAGPLHGRANQEV LEWLFALKEEVNDDYSKDTIEKYLWDTLNSGRVIPGYGHAVLRKTDPRYMAQRKFAMDHF PDYELFKLVSSIYEVAPGVLTEHGKTKNPWPNVDAHSGVLLQYYGLKESSFYTVLFGVSR AFGILAQLITDRAIGASIERPKSYSTEKYKELVKNIESKL
References
External Links
ResourceLink
Saccharomyces Genome Database CIT2
Uniprot IDP08679
Uniprot NameCISY2_YEAST
GenBank Gene IDAY692837
Genebank Protein ID51013125
General Reference
  • Rosenkrantz, M., Alam, T., Kim, K. S., Clark, B. J., Srere, P. A., Guarente, L. P. (1986). "Mitochondrial and nonmitochondrial citrate synthases in Saccharomyces cerevisiae are encoded by distinct homologous genes." Mol Cell Biol 6:4509-4515.3540614
  • Biteau, N., Fremaux, C., Hebrard, S., Menara, A., Aigle, M., Crouzet, M. (1992). "The complete sequence of a 10.8kb fragment to the right of the chromosome III centromere of Saccharomyces cerevisiae." Yeast 8:61-70.1580102
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Liao, X. S., Small, W. C., Srere, P. A., Butow, R. A. (1991). "Intramitochondrial functions regulate nonmitochondrial citrate synthase (CIT2) expression in Saccharomyces cerevisiae." Mol Cell Biol 11:38-46.1986232
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131