You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNADP-specific glutamate dehydrogenase 1
Synonyms
  • NADP-GDH 1
  • NADP-dependent glutamate dehydrogenase 1
Gene NameGDH1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionL-glutamate + H(2)O + NADP(+) = 2-oxoglutarate + NH(3) + NADPH
Cellular LocationNot Available
SMPDB Pathways
Glutamate MetabolismPW002376 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Arginine and proline metabolismec00330 Map00330
Nitrogen metabolismec00910 Map00910
SMPDB Reactions
NADPH + Ammonium + hydron + Oxoglutaric acidwater + NADP + L-Glutamic acid
Ammonia + Oxoglutaric acid + hydron + NADPHL-Glutamic acid + water + NADP
KEGG Reactions
Oxoglutaric acid + NADPH + hydron + AmmoniumNADP + L-Glutamic acid + water
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00153Oxoglutaric acidShow
YMDB00271L-Glutamic acidShow
YMDB00423AmmoniumShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
binding
oxidoreductase activity, acting on the CH-NH2 group of donors, NAD or NADP as acceptor
oxidoreductase activity, acting on the CH-NH2 group of donors
oxidoreductase activity
catalytic activity
Process
cellular amino acid metabolic process
oxidation reduction
metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOR375C
Gene Sequence>1365 bp ATGTCAGAGCCAGAATTTCAACAAGCTTACGAAGAAGTTGTCTCCTCTTTGGAAGACTCT ACTCTTTTCGAACAACACCCAGAATACAGAAAGGTTTTGCCAATTGTTTCTGTTCCAGAA AGAATCATACAATTCAGAGTCACCTGGGAAAATGACAAGGGTGAACAAGAAGTTGCTCAA GGTTACAGAGTCCAATATAACTCCGCCAAGGGTCCATACAAGGGTGGTCTACGTTTCCAT CCTTCCGGGAACTTGTCTATCTTGAAATTCTTGGGTTTCGAACAAATCTTCAAGAACTCC TTGACCGGCCTAGACATGGGTGGTGGTAAAGGTGGTCTATGTGTGGACTTGAAGGGAAGA TCTAATAACGAAATCAGAAGAATCTGTTATGCTTTCATGAGAGAATTGAGCAGACACATT GGTCAAGACACTGACGTGCCAGCTGGTGATATCGGTGTTGGTGGTCGTGAAATTGGTTAC CTGTTCGGTGCTTACAGATCATACAAGAACTCTTGGGAAGGTGTCTTAACCGGTAAGGGT TTGAACTGGGGTGGTTCTTTGATCAGACCAGAAGCCACTGGTTACGGTTTACTTTACTAT ACTCAAGCTATGATCGACTATGCCACAAACGGTAAGGAATCTTTCGAAGGTAAGCGCGTC ACCATCTCTGGTAGTGGTAACGTTGCTCAATACGCTGCCTTGAAGGTTATTGAGCTAGGT GGTACTGTCGTTTCCCTATCTGACTCCAAGGGTTGTATCATCCTTGAAACTGGTATCACC TCCGAACAAGTCGCTGTTATTTCCAGTGCTAAGGTCAACTTCAAGTCCTTGGAACAAATC GTCAACGAATACTCTACTTTCTCCGAAAACAAAGTGCAATACATTGCTGGTGCTCGTCCA TGGACCCACGTCCAAAAGGTCGACATTGCTTTGCCATGTGCCACCCAAAATGAAGTCAGC GGTGAAGAAGCCAAGGCCTTGGTTGCTCAAGGTGTCAAGTTTATTGCCGAAGGTTCCAAC ATGGGTTCCACTCCAGAAGCTATTGCCGTCTTTGAAACTGCTCGTTCCACCGCCACTGGA CCAAGCGAAGCTGTTTGGTACGGTCCACCAAAGGCTGCTAACTTGGGTGGTGTTGCTGTT TCTGGTTTAGAAATGGCACAAAACTCTCAAAGAATCACATGGACTAGCGAAAGAGTTGAC CAAGAGTTGAAGAGAATTATGATCAACTGTTTCAATGAATGTATCGACTATGCCAAGAAG TACACTAAGGACGGTAAGGTCTTGCCATCTTTGGTCAAAGGTGCTAATATCGCAAGTTTC ATCAAGGTCTCTGATGCTATGTTTGACCAAGGTGATGTATTTTAA
Protein Properties
Pfam Domain Function
Protein Residues454
Protein Molecular Weight49569.60156
Protein Theoretical pI5.39
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NADP-specific glutamate dehydrogenase 1 MSEPEFQQAYEEVVSSLEDSTLFEQHPEYRKVLPIVSVPERIIQFRVTWENDKGEQEVAQ GYRVQYNSAKGPYKGGLRFHPSVNLSILKFLGFEQIFKNSLTGLDMGGGKGGLCVDLKGR SNNEIRRICYAFMRELSRHIGQDTDVPAGDIGVGGREIGYLFGAYRSYKNSWEGVLTGKG LNWGGSLIRPEATGYGLVYYTQAMIDYATNGKESFEGKRVTISGSGNVAQYAALKVIELG GTVVSLSDSKGCIISETGITSEQVADISSAKVNFKSLEQIVNEYSTFSENKVQYIAGARP WTHVQKVDIALPCATQNEVSGEEAKALVAQGVKFIAEGSNMGSTPEAIAVFETARSTATG PSEAVWYGPPKAANLGGVAVSGLEMAQNSQRITWTSERVDQELKRIMINCFNECIDYAKK YTKDGKVLPSLVKGANIASFIKVSDAMFDQGDVF
References
External Links
ResourceLink
Saccharomyces Genome Database GDH1
Uniprot IDP07262
Uniprot NameDHE4_YEAST
GenBank Gene IDM11297
Genebank Protein ID171592
General Reference
  • Moye, W. S., Amuro, N., Rao, J. K., Zalkin, H. (1985). "Nucleotide sequence of yeast GDH1 encoding nicotinamide adenine dinucleotide phosphate-dependent glutamate dehydrogenase." J Biol Chem 260:8502-8508.2989290
  • Nagasu, T., Hall, B. D. (1985). "Nucleotide sequence of the GDH gene coding for the NADP-specific glutamate dehydrogenase of Saccharomyces cerevisiae." Gene 37:247-253.2932370
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Norbeck, J., Blomberg, A. (1996). "Protein expression during exponential growth in 0.7 M NaCl medium of Saccharomyces cerevisiae." FEMS Microbiol Lett 137:1-8.8935650
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131