You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameC-1-tetrahydrofolate synthase, cytoplasmic
Synonyms
  • C1-THF synthase
  • Methylenetetrahydrofolate dehydrogenase
  • Methenyltetrahydrofolate cyclohydrolase
  • Formyltetrahydrofolate synthetase
Gene NameADE3
Enzyme Class
Biological Properties
General FunctionInvolved in formate-tetrahydrofolate ligase activity
Specific Function5,10-methylenetetrahydrofolate + NADP(+) = 5,10-methenyltetrahydrofolate + NADPH
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Glyoxylate and dicarboxylate metabolismec00630 Map00630
One carbon pool by folateec00670 Map00670
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + 5,6,7,8-Tetrahydrofolic acid + Formic acidN10-Formyl-THF + phosphate + ADP
(6R)-5,10-Methenyltetrahydrofolic acid + waterN10-Formyl-THF + hydron
NADP + 5,10-Methylene-THF(6R)-5,10-Methenyltetrahydrofolic acid + NADPH
Metabolites
YMDB IDNameView
YMDB00080N10-Formyl-THFShow
YMDB00109Adenosine triphosphateShow
YMDB00139Tetrahydrofolic acidShow
YMDB001765,10-Methenyltetrahydrofolic acidShow
YMDB002605,10-Methylene-THFShow
YMDB00385Formic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB004835,6,7,8-Tetrahydrofolic acidShow
YMDB00515(6R)-5,10-Methenyltetrahydrofolic acidShow
YMDB0051710-Formyltetrahydrofolic acidShow
YMDB00848(6R)-5,10-methylenetetrahydrofolic acidShow
YMDB00862hydronShow
YMDB008795,10-MethenyltetrahydrofolateShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
formate-tetrahydrofolate ligase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
catalytic activity
ATP binding
ligase activity
ligase activity, forming carbon-nitrogen bonds
Process
folic acid and derivative biosynthetic process
cellular metabolic process
metabolic process
cellular aromatic compound metabolic process
folic acid and derivative metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR204W
Gene Sequence>2841 bp ATGGCTGGTCAAGTGTTGGACGGCAAAGCATGCGCTCAGCAGTTTAGAAGCAATATTGCT AATGAAATCAAAAGCATTCAAGGTCACGTGCCTGGGTTTGCACCTAACCTTGCCATCATT CAAGTAGGCAACAGACCAGACTCAGCCACATATGTACGCATGAAGCGTAAGGCAGCTGAA GAGGCCGGCATTGTTGCTAATTTCATTCATTTAGATGAATCCGCTACTGAATTTGAAGTT CTGCGTTACGTGGACCAGCTGAATGAGGACCCACATACACACGGTATTATCGTGCAACTA CCATTACCCGCTCATTTGGACGAGGATAGAATCACCTCGAGAGTGTTGGCAGAAAAGGAC GTGGACGGGTTCGGGCCCACCAACATTGGCGAATTGAATAAGAAGAACGGACACCCATTC TTTTTGCCCTGCACGCCCAAGGGGATCATTGAGCTGCTTCACAAGGCCAACGTCACGATT GAAGGTTCCCGGTCCGTTGTGATCGGAAGATCTGACATTGTTGGCTCTCCTGTTGCAGAA TTGTTAAAATCTCTAAACTCCACCGTCACCATCACTCATTCTAAAACCCGTGATATCGCA TCATACTTACACGACGCGGACATCGTAGTCGTTGCCATCGGCCAACCAGAATTTGTGAAG GGTGAATGGTTCAAACCAAGAGACGGCACTTCCAGTGATAAGAAAACCGTGGTAATTGAT GTTGGCACCAACTACGTTGCTGATCCTTCCAAAAAGTCCGGTTTCAAATGTGTTGGTGAC GTTGAGTTCAATGAAGCAATCAAATACGTCCATCTAATCACTCCAGTGCCCGGTGGTGTG GGCCCCATGACGGTGGCTATGTTAATGCAAAATACCTTGATTGCTGCCAAACGCCAAATG GAAGAATCCTCGAAGCCTTTGCAGATTCCTCCCTTGCCATTGAAGTTGCTAACACCTGTT CCTTCCGATATAGACATCTCCAGAGCACAACAGCCAAAGCTTATCAACCAGCTTGCTCAA GAATTGGGTATTTACTCTCATGAGTTGGAGCTGTACGGACATTACAAGGCCAAAATTTCT CCTAAAGTCATCGAAAGGCTGCAGACGCGCCAAAATGGTAAGTACATCTTGGTGTCTGGT ATCACACCAACACCACTGGGAGAGGGTAAATCCACTACAACAATGGGTCTTGTCCAGGCA CTAACGGCTCACTTGGGCAAGCCAGCCATTGCGAACGTCAGACAACCCTCCCTAGGACCC ACTTTAGGTGTCAAAGGTGGTGCTGCGGGTGGTGGTTATTCCCAAGTCATCCCAATGGAC GAATTCAACTTACATTTGACTGGTGACATTCACGCCATTGGTGCGGCTAACAACCTACTT GCTGCCGCTATTGACACTAGAATGTTCCATGAGACCACTCAAAAGAACGACGCTACCTTC TACAACAGACTAGTGCCTAGAAAGAACGGAAAGAGAAAGTTTACTCCCTCCATGCAAAGA AGATTGAACAGACTGGGTATTCAAAAGACCAACCCCGATGATCTAACACCCGAAGAGATC AACAAATTCGCCAGATTGAACATTGACCCGGACACTATTACTATCAAGAGGGTGGTCGAT ATCAACGACAGAATGTTAAGACAAATCACCATTGGTCAAGCCCCTACCGAGAAGAACCAC ACAAGAGTTACTGGATTCGATATCACCGTTGCTTCTGAATTGATGGCTATTCTTGCTCTT TCAAAGGACTTGAGGGACATGAAGGAACGTATTGGAAGAGTCGTTGTTGCTGCTGACGTA AACAGGTCTCCAGTCACTGTTGAAGATGTGGGTTGTACCGGTGCCTTAACCGCTTTATTA AGAGACGCTATCAAGCCCAACTTGATGCAAACTTTAGAAGGTACTCCTGTCTTGGTCCAT GCCGGCCCATTTGCCAACATCTCTATCGGTGCCTCTTCTGTTATTGCTGATCGCGTGGCT TTGAAATTGGTTGGTACCGAGCCAGAGGCAAAAACAGAAGCTGGTTATGTGGTTACTGAA GCAGGGTTCGATTTCACTATGGGTGGTGAAAGATTCTTCAACATCAAGTGCCGTTCCTCT GGATTGACACCTAATGCTGTGGTCTTGGTTGCTACTGTTAGGGCATTGAAGTCACACGGT GGTGCTCCAGATGTCAAACCTGGCCAACCTTTACCTTCCGCATACACTGAAGAGAATATC GAGTTTGTCGAAAAAGGTGCCGCTAACATGTGTAAACAAATTGCCAACATTAAGCAATTT GGCGTCCCCGTCGTTGTCGCAATTAACAAGTTTGAAACTGACACTGAAGGTGAAATAGCC GCCATTAGAAAAGCCGCTTTGGAAGCTGGTGCATTTGAAGCCGTAACCTCTAACCATTGG GCCGAAGGTGGTAAAGGTGCTATCGACTTGGCCAAGGCCGTCATCGAAGCTTCCAACCAA CCAGTGGACTTCCATTTCCTATATGACGTTAACTCCTCCGTTGAAGACAAATTAACTACT ATCGTTCAAAAGATGTACGGTGGTGCCGCAATCGATATCTTGCCTGAAGCACAACGCAAG ATTGACATGTACAAGGAACAAGGTTTCGGTAACTTGCCAATTTGTATCGCCAAGACACAA TACTCTTTATCCCACGATGCAACTTTGAAAGGTGTTCCAACCGGGTTCACTTTCCCCATC AGAGACGTCAGATTGTCTAATGGTGCTGGATACTTATACGCTCTTGCCGCCGAAATACAA ACCATTCCTGGTTTGGCTACCTATGCTGGTTACATGGCCGTGGAAGTCGATGATGACGGT GAGATCGATGGCCTGTTCTAA
Protein Properties
Pfam Domain Function
Protein Residues946
Protein Molecular Weight102204.0
Protein Theoretical pI6.83
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>C-1-tetrahydrofolate synthase, cytoplasmic MAGQVLDGKACAQQFRSNIANEIKSIQGHVPGFAPNLAIIQVGNRPDSATYVRMKRKAAE EAGIVANFIHLDESATEFEVLRYVDQLNEDPHTHGIIVQLPLPAHLDEDRITSRVLAEKD VDGFGPTNIGELNKKNGHPFFLPCTPKGIIELLHKANVTIEGSRSVVIGRSDIVGSPVAE LLKSLNSTVTITHSKTRDIASYLHDADIVVVAIGQPEFVKGEWFKPRDGTSSDKKTVVID VGTNYVADPSKKSGFKCVGDVEFNEAIKYVHLITPVPGGVGPMTVAMLMQNTLIAAKRQM EESSKPLQIPPLPLKLLTPVPSDIDISRAQQPKLINQLAQELGIYSHELELYGHYKAKIS PKVIERLQTRQNGKYILVSGITPTPLGEGKSTTTMGLVQALTAHLGKPAIANVRQPSLGP TLGVKGGAAGGGYSQVIPMDEFNLHLTGDIHAIGAANNLLAAAIDTRMFHETTQKNDATF YNRLVPRKNGKRKFTPSMQRRLNRLGIQKTNPDDLTPEEINKFARLNIDPDTITIKRVVD INDRMLRQITIGQAPTEKNHTRVTGFDITVASELMAILALSKDLRDMKERIGRVVVAADV NRSPVTVEDVGCTGALTALLRDAIKPNLMQTLEGTPVLVHAGPFANISIGASSVIADRVA LKLVGTEPEAKTEAGYVVTEAGFDFTMGGERFFNIKCRSSGLTPNAVVLVATVRALKSHG GAPDVKPGQPLPSAYTEENIEFVEKGAANMCKQIANIKQFGVPVVVAINKFETDTEGEIA AIRKAALEAGAFEAVTSNHWAEGGKGAIDLAKAVIEASNQPVDFHFLYDVNSSVEDKLTT IVQKMYGGAAIDILPEAQRKIDMYKEQGFGNLPICIAKTQYSLSHDATLKGVPTGFTFPI RDVRLSNGAGYLYALAAEIQTIPGLATYAGYMAVEVDDDGEIDGLF
References
External Links
ResourceLink
Saccharomyces Genome Database ADE3
Uniprot IDP07245
Uniprot NameC1TC_YEAST
GenBank Gene IDAY692966
Genebank Protein ID51013383
General Reference
  • Staben, C., Rabinowitz, J. C. (1986). "Nucleotide sequence of the Saccharomyces cerevisiae ADE3 gene encoding C1-tetrahydrofolate synthase." J Biol Chem 261:4629-4637.3514599
  • Guerreiro, P., Barreiros, T., Soares, H., Cyrne, L., Maia e Silva, A., Rodrigues-Pousada, C. (1996). "Sequencing of a 17.6 kb segment on the right arm of yeast chromosome VII reveals 12 ORFs, including CCT, ADE3 and TR-I genes, homologues of the yeast PMT and EF1G genes, of the human and bacterial electron-transferring flavoproteins (beta-chain) and of the Escherichia coli phosphoserine phosphohydrolase, and five new ORFs." Yeast 12:273-280.8904340
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Barlowe, C. K., Williams, M. E., Rabinowitz, J. C., Appling, D. R. (1989). "Site-directed mutagenesis of yeast C1-tetrahydrofolate synthase: analysis of an overlapping active site in a multifunctional enzyme." Biochemistry 28:2099-2106.2541774
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956