You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGalactokinase
Synonyms
  • Galactose kinase
Gene NameGAL1
Enzyme Class
Biological Properties
General FunctionInvolved in galactokinase activity
Specific FunctionATP + D-galactose = ADP + alpha-D-galactose 1- phosphate
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Galactose metabolismec00052 Map00052
SMPDB Reactions
Adenosine triphosphate + D-GalactoseADP + hydron + Galactose 1-phosphate
KEGG Reactions
Adenosine triphosphate + D-GalactoseGalactose 1-phosphate + hydron + ADP
Metabolites
YMDB IDNameView
YMDB00004Galactose 1-phosphateShow
YMDB00072D-GalactoseShow
YMDB00109Adenosine triphosphateShow
YMDB00789GalactoseShow
YMDB00862hydronShow
YMDB00914ADPShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
kinase activity
phosphotransferase activity, alcohol group as acceptor
catalytic activity
galactokinase activity
transferase activity
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
Process
phosphorus metabolic process
metabolic process
phosphate metabolic process
phosphorylation
carbohydrate phosphorylation
cellular metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
galactose metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR020W
Gene Sequence>1587 bp ATGACTAAATCTCATTCAGAAGAAGTGATTGTACCTGAGTTCAATTCTAGCGCAAAGGAA TTACCAAGACCATTGGCCGAAAAGTGCCCGAGCATAATTAAGAAATTTATAAGCGCTTAT GATGCTAAACCGGATTTTGTTGCTAGATCGCCTGGTAGAGTCAATCTAATTGGTGAACAT ATTGATTATTGTGACTTCTCGGTTTTACCTTTAGCTATTGATTTTGATATGCTTTGCGCC GTCAAAGTTTTGAACGAGAAAAATCCATCCATTACCTTAATAAATGCTGATCCCAAATTT GCTCAAAGGAAGTTCGATTTGCCGTTGGACGGTTCTTATGTCACAATTGATCCTTCTGTG TCGGACTGGTCTAATTACTTTAAATGTGGTCTCCATGTTGCTCACTCTTTTCTAAAGAAA CTTGCACCGGAAAGGTTTGCCAGTGCTCCTCTGGCCGGGCTGCAAGTCTTCTGTGAGGGT GATATACCAACTGGCAGTGGATTGTCTTCTTCGGCCGCATTCATTTGTGCCGTTGCTTTA GCTGTTGTTAAAGCGAATATGGGCCCTGGTTATCATATGTCCAAGCAAAATTTAATGCGT ATCACGGTCGTTGCAGACATTATGTTGGTGTTAACAATGGCGGTATGGATCAGGCTGCCT CTGTTTGCGGTGAGGAAGATCATGCTCTATACGTTGAGTTCAAACGCAGTTGAGGCTACC CCGTTTAAATTTCCGCAATTAAAAAACCATGAAATTAGCTTTGTTATTGCGAACACCCTT GTTGTATCTAACAAGTTTGAAACCGCCCCAACCAACTATAATTTAAGAGTGGTAGAAGTC ACTACAGCTGCAAATGTTTTAGCTGCCACGTACGGTGTTGTTTTACCTTCTGGAAAAGAA GGATCGAGCACGAATAAAGGTAATCTAAGAGATTTCATGAACGTTTATTATGCCAGATAT CACAACATTTCCACACCCTGGAACGGCGATATTGAATCCGGCATCGAACGGTTAACAAAG ATGCTAGTATTAGTTGAAGAGTCTCTCGCCAATAAGAAACAGGGCTTTAGTGTTGACGAT GTCGCACAATCCTTGAATTGTTCTCGCGAAGAATTCACAAGAGACTACTTAACAACATCT CCAGTGAGATTTCAAGTCTTAAAGCTATATCAGAGGGCTAAGCATGTGTATTCTGAATCT TTAAGAGTCTTGAAGGCTGTGAAATTAATGACTACCGCGAGCTTTACTGCCGACGAAGAC TTTTTCAAGCAATTTGGTGTCTTGATGAACGAGTCTCAAGCTTCTTGCGATAAACTTTAC GAATGTTCTTGTCCAGAGATTGACAAAATTTGTTCCATTGCTTTGTCAAATGGATCATAT GGTTCCCGTTTGACTGGAGCTGGCTGGGGTGGTTGTACTGTTCACTTGGTTCCAGGGGGC CCAAATAACGGCAACATAGAAAAGGTAAAAGAAGCCCTTGCCAATGAGTTCTACAAGGTC AAGTACCCTAAGATCACTGATGCTGAGCTAGAAAATGCTATCATCGTCTCTAAACCAGCA TTGGGCAGCTGTCTATATGAATTATAA
Protein Properties
Pfam Domain Function
Protein Residues528
Protein Molecular Weight57943.80078
Protein Theoretical pI6.72
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Galactokinase MTKSHSEEVIVPEFNSSAKELPRPLAEKCPSIIKKFISAYDAKPDFVARSPGRVNLIGEH IDYCDFSVLPLAIDFDMLCAVKVLNEKNPSITLINADPKFAQRKFDLPLDGSYVTIDPSV SDWSNYFKCGLHVAHSFLKKLAPERFASAPLAGLQVFCEGDVPTGSGLSSSAAFICAVAL AVVKANMGPGYHMSKQNLMRITVVAEHYVGVNNGGMDQAASVCGEEDHALYVEFKPQLKA TPFKFPQLKNHEISFVIANTLVVSNKFETAPTNYNLRVVEVTTAANVLAATYGVVLLSGK EGSSTNKGNLRDFMNVYYARYHNISTPWNGDIESGIERLTKMLVLVEESLANKKQGFSVD DVAQSLNCSREEFTRDYLTTSPVRFQVLKLYQRAKHVYSESLRVLKAVKLMTTASFTADE DFFKQFGALMNESQASCDKLYECSCPEIDKICSIALSNGSYGSRLTGAGWGGCTVHLVPG GPNGNIEKVKEALANEFYKVKYPKITDAELENAIIVSKPALGSCLYEL
References
External Links
ResourceLink
Saccharomyces Genome Database GAL1
Uniprot IDP04385
Uniprot NameGAL1_YEAST
GenBank Gene IDK01609
Genebank Protein ID171567
General Reference
  • Citron, B. A., Donelson, J. E. (1984). "Sequence of the Saccharomyces GAL region and its transcription in vivo." J Bacteriol 158:269-278.6715281
  • Smits, P. H., De Haan, M., Maat, C., Grivell, L. A. (1994). "The complete sequence of a 33 kb fragment on the right arm of chromosome II from Saccharomyces cerevisiae reveals 16 open reading frames, including ten new open reading frames, five previously identified genes and a homologue of the SCO1 gene." Yeast 10 Suppl A:S75-S80.8091864
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Johnston, M., Davis, R. W. (1984). "Sequences that regulate the divergent GAL1-GAL10 promoter in Saccharomyces cerevisiae." Mol Cell Biol 4:1440-1448.6092912
  • Schlesinger, D. H., Schell, M. A., Wilson, D. B. (1977). "The NH2-terminal sequences of galactokinase from Escherichia coli and Saccharomyces cerevisiae." FEBS Lett 83:45-47.200486
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956