You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name3-isopropylmalate dehydrogenase
Synonyms
  • 3-IPM-DH
  • IMDH
  • Beta-IPM dehydrogenase
Gene NameLEU2
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionCatalyzes the oxidation of 3-carboxy-2-hydroxy-4- methylpentanoate (3-isopropylmalate) to 3-carboxy-4-methyl-2- oxopentanoate. The product decarboxylates to 4-methyl-2 oxopentanoate
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB ReactionsNot Available
KEGG Reactions
NAD + 3-IsopropylmalateNADH + (2S)-2-Isopropyl-3-oxosuccinate + hydron
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB003683-IsopropylmalateShow
YMDB00388KetoleucineShow
YMDB00412NAD(+)Show
YMDB00449(2S)-2-Isopropyl-3-oxosuccinateShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
ion binding
catalytic activity
cation binding
3-isopropylmalate dehydrogenase activity
metal ion binding
oxidoreductase activity
magnesium ion binding
oxidoreductase activity, acting on CH-OH group of donors
binding
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
NAD or NADH binding
nucleotide binding
Process
leucine metabolic process
leucine biosynthetic process
metabolic process
cellular metabolic process
oxidation reduction
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
branched chain family amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 3
LocusYCL018W
Gene Sequence>1095 bp ATGTCTGCCCCTAAGAAGATCGTCGTTTTGCCAGGTGACCACGTTGGTCAAGAAATCACA GCCGAAGCCATTAAGGTTCTTAAAGCTATTTCTGATGTTCGTTCCAATGTCAAGTTCGAT TTCGAAAATCATTTAATTGGTGGTGCTGCTATCGATGCTACAGGTGTCCCACTTCCAGAT GAGGCGCTGGAAGCCTCCAAGAAGGTTGATGCCGTTTTGTTAGGTGCTGTGGGTGGTCCT AAATGGGGTACCGGTAGTGTTAGACCTGAACAAGGTTTACTAAAAATCCGTAAAGAACTT CAATTGTACGCCAACTTAAGACCATGTAACTTTGCATCCGACTCTCTTTTAGACTTATCT CCAATCAAGCCACAATTTGCTAAAGGTACTGACTTCGTTGTTGTCAGAGAATTAGTGGGA GGTATTTACTTTGGTAAGAGAAAGGAAGACGATGGTGATGGTGTCGCTTGGGATAGTGAA CAATACACCGTTCCAGAAGTGCAAAGAATCACAAGAATGGCCGCTTTCATGGCCCTACAA CATGAGCCACCATTGCCTATTTGGTCCTTGGATAAAGCTAATGTTTTGGCCTCTTCAAGA TTATGGAGAAAAACTGTGGAGGAAACCATCAAGAACGAATTCCCTACATTGAAGGTTCAA CATCAATTGATTGATTCTGCCGCCATGATCCTAGTTAAGAACCCAACCCACCTAAATGGT ATTATAATCACCAGCAACATGTTTGGTGATATCATCTCCGATGAAGCCTCCGTTATCCCA GGTTCCTTGGGTTTGTTGCCATCTGCGTCCTTGGCCTCTTTGCCAGACAAGAACACCGCA TTTGGTTTGTACGAACCATGCCACGGTTCTGCTCCAGATTTGCCAAAGAATAAGGTCAAC CCTATCGCCACTATCTTGTCTGCTGCAATGATGTTGAAATTGTCATTGAACTTGCCTGAA GAAGGTAAGGCCATTGAAGATGCAGTTAAAAAGGTTTTGGATGCAGGTATCAGAACTGGT GATTTAGGTGGTTCCAACAGTACCACGGAAGTCGGTGATGCTGTCGCCGAAGAAGTTAAG AAAATCCTTGCTTAA
Protein Properties
Pfam Domain Function
Protein Residues364
Protein Molecular Weight38952.5
Protein Theoretical pI5.48
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>3-isopropylmalate dehydrogenase MSAPKKIVVLPGDHVGQEITAEAIKVLKAISDVRSNVKFDFENHLIGGAAIDATGVPLPD EALEASKKADAVLLGAVGGPKWGTGSVRPEQGLLKIRKELQLYANLRPCNFASDSLLDLS PIKPQFAKGTDFVVVRELVGGIYFGKRKEDDGDGVAWDSEQYTVPEVQRITRMAAFMALQ HEPPLPIWSLDKANVLASSRLWRKTVEETIKNEFPTLKVQHQLIDSAAMILVKNPTHLNG IIITSNMFGDIISDEASVIPGSLGLLPSASLASLPDKNTAFGLYEPCHGSAPDLPKNKVN PIATILSAAMMLKLSLNLPEEGKAIEDAVKKVLDAGIRTGDLGGSNSTTEVGDAVAEEVK KILA
References
External Links
ResourceLink
Saccharomyces Genome Database LEU2
Uniprot IDP04173
Uniprot NameLEU3_YEAST
GenBank Gene IDX03840
Genebank Protein ID4698
General Reference
  • Warmington, J. R., Anwar, R., Newlon, C. S., Waring, R. B., Davies, R. W., Indge, K. J., Oliver, S. G. (1986). "A 'hot-spot' for Ty transposition on the left arm of yeast chromosome III." Nucleic Acids Res 14:3475-3485.3010239
  • Andreadis, A., Hsu, Y. P., Hermodson, M., Kohlhaw, G., Schimmel, P. (1984). "Yeast LEU2. Repression of mRNA levels by leucine and primary structure of the gene product." J Biol Chem 259:8059-8062.6330094
  • Oliver, S. G., van der Aart, Q. J., Agostoni-Carbone, M. L., Aigle, M., Alberghina, L., Alexandraki, D., Antoine, G., Anwar, R., Ballesta, J. P., Benit, P., et, a. l. .. (1992). "The complete DNA sequence of yeast chromosome III." Nature 357:38-46.1574125
  • Froman, B. E., Tait, R. C., Rodriguez, R. L. (1984). "Nucleotide sequence of the 3' terminal region of the LEU2 gene from Saccharomyces cerevisiae." Gene 31:257-261.6396161
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956