You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAmidophosphoribosyltransferase
Synonyms
  • ATase
  • Glutamine phosphoribosylpyrophosphate amidotransferase
Gene NameADE4
Enzyme Class
Biological Properties
General FunctionInvolved in amidophosphoribosyltransferase activity
Specific Function5-phospho-beta-D-ribosylamine + diphosphate + L-glutamate = L-glutamine + 5-phospho-alpha-D-ribose 1-diphosphate + H(2)O
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
water + L-Glutamine + Phosphoribosyl pyrophosphatePyrophosphate + L-Glutamic acid + 5-Phosphoribosylamine
Metabolites
YMDB IDNameView
YMDB00002L-GlutamineShow
YMDB000675-PhosphoribosylamineShow
YMDB00219PyrophosphateShow
YMDB00271L-Glutamic acidShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
transferase activity, transferring pentosyl groups
amidophosphoribosyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
Process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
cellular metabolic process
cellular aromatic compound metabolic process
nucleobase metabolic process
nucleoside metabolic process
purine base metabolic process
purine base biosynthetic process
metabolic process
nitrogen compound metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR300C
Gene Sequence>1533 bp ATGTGTGGTATTTTAGGTATTGTATTAGCAAACCAAACCACTCCAGTAGCTCCGGAGTTA TGTGATGGATGCATTTTTCTACAACATCGTGGACAAGATGCAGCTGGTATAGCTACCTGT GGTTCTCGTGGTAGAGTCTGCCAATGTAAAGGTAATGGTATGGCTCGTGACGTATTTACC CAACGTGTTTCCGGTCTTGCTGGTTCCATGGGTATTGCCCACTTGAGATATCCTACACCG GGTCTTCGGCTAATTCTAGAAGCGCAACCATTTTACGTCAATAGTCCTTACGGTATTAAC TTGGCACATAACGGTAACTTGGTGAATACTGCATCATTGAAGAGATATATGGATGAAGAC GTTCATAGACATATTAACACGGACAGTGATTCGGAGTTACTATTGAATATTTTTGCTGCT GAACTGGAAAAACATAACAAGTACAGAGTTAACAATGAAGATGGTTTCTCCAACGCGTTA GAAGGTGTTTACCGTTTATGCCGTGGCGGTTATGCTTGCGTTGGTTTACTTGCCGGTTTT GCATTATTTGGTTTCAGAGATCCAAATGGTATTAGGCCATTATTGTTCGGTGAAAGAGAA AATCCGGACGGCACTAAGGACTATATGTTAGCTTCAGAAAGTGTTGTTTTCAAAGCTCAC AACTTTACTAAATATCGTGACTTAAAGCCTGGCGAGGCAGGTATCATCCCTAAGAACTGT AGCAAAGGTGAACCTGAGTTCAAACAAGTGGTTCCTATTAACTCTTATAGACCTGATTTA TTTGAATACGTATATTTCGCCAGACCGGACAGTGTCTTGGATGGAATATCAGTTTATCAC ACAAGATTGGCTATGGGTTCTAAATTAGCGCAAAATATTCTAAAGCAACTGAAGCCAGAA GATATTGATGTTGTTATTCCCGTCCCAGATACTGCAAGAACATGTGCACTAGAATGTGCT AATGTGTTAGGTAAGCCTTATAGAGAGGGCTTTGTTAAAAACAGATACGTGGGCAGGACA TTTATCATGCCAAACCAGAGGGAAAGGGTTTCTTCAGTAAGGAGGAAGCTTAACCCTATG GAGTCTGAATTTAAGGGTAAGAAGGTTCTGATAGTGGATGATTCTATTGTCAGAGGTACT ACTTCAAAAGAGATTGTTAACATGGCCAAGGAATCCGGTGCAACAAAGGTTTACTTCGCT TCAGCTGCCCCAGCCATTCGTTACAACCATATTTATGGTATTGACTTAACAGACACAAAG AACTTGATTGCTTATAACAGAACCGATGAAGAAGTGGCGGAAGTAATCGGTTGTGAAAGA GTCATTTACCAATCATTGGAAGATTTGATTGATTGTTGTAAAACTGATAAAATAACCAAA TTCGAAGATGGTGTATTTACCGGAAATTATGTCACTGGTGTTGAAGACGGTTATATTCAA GAATTGGAAGAAAAACGTGAATCGATCGCAAATAATTCATCAGATATGAAGGCTGAAGTC GATATCGGATTATATAATTGTGCAGATTATTGA
Protein Properties
Pfam Domain Function
Protein Residues510
Protein Molecular Weight56718.89844
Protein Theoretical pI6.2
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Amidophosphoribosyltransferase MCGILGIVLANQTTPVAPELCDGCIFLQHRGQDAAGIATCGSRGRIYQCKGNGMARDVFT QQRVSGLAGSMGIAHLRYPTAGSSANSEAQPFYVNSPYGINLAHNGNLVNTASLKRYMDE DVHRHINTDSDSELLLNIFAAELEKHNKYRVNNEDVFHALEGVYRLCRGGYACVGLLAGF ALFGFRDPNGIRPLLFGERENPDGTKDYMLASESVVFKAHNFTKYRDLKPGEAVIIPKNC SKGEPEFKQVVPINSYRPDLFEYVYFARPDSVLDGISVYHTRLAMGSKLAENILKQLKPE DIDVVIPVPDTARTCALECANVLGKPYREGFVKNRYVGRTFIMPNQRERVSSVRRKLNPM ESEFKGKKVLIVDDSIVRGTTSKEIVNMAKESGATKVYFASAAPAIRYNHIYGIDLTDTK NLIAYNRTDEEVAEVIGCERVIYQSLEDLIDCCKTDKITKFEDGVFTGNYVTGVEDGYIQ ELEEKRESIANNSSDMKAEVDIGLYNCADY
References
External Links
ResourceLink
Saccharomyces Genome Database ADE4
Uniprot IDP04046
Uniprot NamePUR1_YEAST
GenBank Gene IDK02203
Genebank Protein ID171009
General Reference
  • Mantsala, P., Zalkin, H. (1984). "Glutamine nucleotide sequence of Saccharomyces cerevisiae ADE4 encoding phosphoribosylpyrophosphate amidotransferase." J Biol Chem 259:8478-8484.6376509
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956