You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoglycerate mutase 1
Synonyms
  • PGAM 1
  • BPG-dependent PGAM 1
  • MPGM 1
  • Phosphoglyceromutase 1
Gene NameGPM1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionInterconversion of 3- and 2-phosphoglycerate with 2,3- bisphosphoglycerate as the primer of the reaction. Can also Catalyze the reaction of EC 5.4.2.4 (synthase) and EC 3.1.3.13 (phosphatase), but with a reduced activity
Cellular LocationNot Available
SMPDB Pathways
Ethanol fermentationPW002448 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycolysis / Gluconeogenesisec00010 Map00010
Methane metabolismec00680 Map00680
SMPDB ReactionsNot Available
KEGG Reactions
3-phospho-D-glyceroyl dihydrogen phosphate2,3-bisphospho-D-glyceric acid + hydron
2-phospho-D-glyceric acid3-phospho-D-glyceric acid
Metabolites
YMDB IDNameView
YMDB003413-Phosphoglyceric acidShow
YMDB006712,3-bisphospho-D-glyceric acidShow
YMDB006723-phospho-D-glyceroyl dihydrogen phosphateShow
YMDB006752-phospho-D-glyceric acidShow
YMDB007563-phospho-D-glyceric acidShow
YMDB00862hydronShow
YMDB009852-phospho-d-glycerateShow
GO Classification
Component
Not Available
Function
isomerase activity
intramolecular transferase activity
intramolecular transferase activity, phosphotransferases
catalytic activity
Process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL152C
Gene Sequence>741 bp CCAAAGTTAGTTTTAGTTAGACACGGTCAATCCGAATGGAACGAAAAGAACTTATTCACC GGTTGGGTTGATGTTAAATTGTCTGCCAAGGGTCAACAAGAAGCCGCTAGAGCCGGTGAA TTGTTGAAGGAAAAGAAGGTCTACCCAGACGTCTTGTACACTTCCAAGTTGTCCAGAGCT ATCCAAACTGCTAACATTGCTTTGGAAAAGGCTGACAGATTATGGATTCCAGTCAACAGA TCCTGGAGATTGAACGAAAGACATTACGGTGACTTACAAGGTAAGGACAAGGCTGAAACT TTGAAGAAGTTCGGTGAAGAAAAATTCAACACCTACAGAAGATCCTTCGATGTTCCACCT CCACCAATCGACGCTTCTTCTCCATTCTCTCAAAAGGGTGATGAAAGATACAAGTACGTT GACCCAAATGTCTTGCCAGAAACTGAATCTTTGGCTTTGGTCATTGACAGATTGTTGCCA TACTGGCAAGATGTCATTGCCAAGGACTTGTTGAGTGGTAAGACCGTCATGATCGCCGCT CACGGTAACTCCTTGAGAGGTTTGGTTAAGCACTTGGAAGGTATCTCTGATGCTGACATT GCTAAGTTGAACATCCCAACTGGTATTCCATTGGTCTTCGAATTGGACGAAAACTTGAAG CCATCTAAGCCATCTTACTACTTGGACCCAGAAGCTGCCGCTGCTGGTGCCGCTGCTGTT GCCAACCAAGGTAAGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues247
Protein Molecular Weight27608.30078
Protein Theoretical pI9.34
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoglycerate mutase 1 MPKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSR AIQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVP PPPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIA AHGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAA VANQGKK
References
External Links
ResourceLink
Saccharomyces Genome Database GPM1
Uniprot IDP00950
Uniprot NamePMG1_YEAST
GenBank Gene IDX06408
Genebank Protein ID1326042
PDB ID
1BQ4
General Reference
  • Fothergill, L. A., Harkins, R. N. (1982). "The amino acid sequence of yeast phosphoglycerate mutase." Proc R Soc Lond B Biol Sci 215:19-44.6127696
  • White, M. F., Fothergill-Gilmore, L. A. (1988). "Sequence of the gene encoding phosphoglycerate mutase from Saccharomyces cerevisiae." FEBS Lett 229:383-387.2831102
  • Heinisch, J., von Borstel, R. C., Rodicio, R. (1991). "Sequence and localization of the gene encoding yeast phosphoglycerate mutase." Curr Genet 20:167-171.1834353
  • Vandenbol, M., Bolle, P. A., Dion, C., Portetelle, D., Hilger, F. (1994). "DNA sequencing of a 36.2 kb fragment located between the FAS1 and LAP loci of chromosome XI of Saccharomyces cerevisiae." Yeast 10 Suppl A:S35-S40.8091859
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Rodicio, R., Heinisch, J. J., Hollenberg, C. P. (1993). "Transcriptional control of yeast phosphoglycerate mutase-encoding gene." Gene 125:125-133.8462867
  • Norbeck, J., Blomberg, A. (1997). "Two-dimensional electrophoretic separation of yeast proteins using a non-linear wide range (pH 3-10) immobilized pH gradient in the first dimension; reproducibility and evidence for isoelectric focusing of alkaline (pI > 7) proteins." Yeast 13:1519-1534.9509572
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Winn, S. I., Watson, H. C., Harkins, R. N., Fothergill, L. A. (1981). "Structure and activity of phosphoglycerate mutase." Philos Trans R Soc Lond B Biol Sci 293:121-130.6115412
  • Rigden, D. J., Alexeev, D., Phillips, S. E., Fothergill-Gilmore, L. A. (1998). "The 2.3 A X-ray crystal structure of S. cerevisiae phosphoglycerate mutase." J Mol Biol 276:449-459.9512715