You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCitrate synthase, mitochondrial
SynonymsNot Available
Gene NameCIT1
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
Specific FunctionAcetyl-CoA + H(2)O + oxaloacetate = citrate + CoA
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Glyoxylate and dicarboxylate metabolismec00630 Map00630
SMPDB ReactionsNot Available
KEGG Reactions
Acetyl-CoA + water + Oxalacetic acidhydron + Citric acid + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00086Citric acidShow
YMDB00235Oxalacetic acidShow
YMDB00312Acetyl-CoAShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
citrate (Si)-synthase activity
transferase activity, transferring acyl groups
catalytic activity
transferase activity
transferase activity, transferring acyl groups, acyl groups converted into alkyl on transfer
Process
cellular carbohydrate metabolic process
cellular metabolic process
primary metabolic process
carbohydrate metabolic process
cofactor metabolic process
coenzyme metabolic process
acetyl-CoA metabolic process
acetyl-CoA catabolic process
tricarboxylic acid cycle
metabolic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNR001C
Gene Sequence>1440 bp ATGTCAGCGATATTATCAACAACTAGCAAAAGTTTCTTATCAAGGGGCTCCACAAGACAA TGTCAAAATATGCAAAAGGCTCTTTTTGCACTATTGAATGCTCGCCACTATAGTAGCGCC TCCGAACAAACGTTGAAGGAGAGATTTGCTGAAATTATCCCAGCAAAGGCAGAAGAAATT AAAAAATTCAAGAAAGAACACGGTAAAACCGTTATTGGTGAAGTTCTTTTGGAGCAAGCT TATGGTGGTATGAGAGGTATTAAAGGCCTTGTTTGGGAAGGTTCCGTGTTAGACCCCGAA GAAGGTATTAGATTTAGGGGTCGTACTATTCCAGAAATTCAAAGGGAACTACCAAAGGCT GAGGGTAGTACAGAACCTTTGCCAGAAGCTTTATTTTGGTTGCTTTTGACTGGTGAAATA CCTACTGACGCTCAAGTTAAAGCCCTTTCTGCTGATTTAGCTGCCAGATCAGAAATTCCA GAGCACGTTATCCAACTTTTAGATAGCCTCCCAAAAGATCTACATCCAATGGCGCAATTT TCTATTGCCGTGACTGCTTTAGAAAGCGAGTCTAAGTTTGCCAAAGCATATGCTCAAGGT GTATCCAAGAAAGAATATTGGAGCTATACATTTGAAGATTCGTTAGATCTGCTGGGTAAA TTACCTGTTATTGCTTCCAAAATTTATCGTAATGTGTTCAAGGATGGTAAAATTACTTCA ACCGATCCTAATGCTGACTATGGTAAAAATTTGGCCCAACTTTTGGGCTACGAAAACAAG GATTTTATTGACTTAATGAGACTATATTTAACTATTCATTCTGATCATGAAGGTGGTAAC GTTTCTGCCCATACTACACATTTAGTGGGTTCTGCCTTATCTTCGCCATACTTATCTTTG GCCGCTGGTTTGAATGGTTTAGCTGGCCCATTACATGGTCGTGCCAATCAAGAAGTTTTA GAATGGCTATTTAAATTGAGAGAAGAAGTGAAAGGTGACTATTCAAAAGAAACAATTGAA AAGTACTTGTGGGATACTTTGAACGCAGGGAGAGTTGTTCCTGGTTATGGCCATGCGGTT TTGAGAAAAACTGATCCTCGTTATACGGCTCAACGTGAATTCGCATTGAAACATTTCCCA GATTACGAGTTATTTAAGTTGGTCTCCACCATTTATGAAGTTGCCCCAGGGGTTTTAACT AAGCATGGTAAAACTAAGAACCCATGGCCAAATGTTGATTCACATTCCGGTGTTTTATTG CAATACTATGGTCTAACTGAGGCTTCGTTCTACACTGTATTGTTTGGTGTTGCCAGAGCT ATTGGTGTGTTACCCCAATTAATCATCGATAGGGCTGTTGGTGCTCCAATCGAAAGGCCA AAATCATTCTCCACCGAAAAATACAAGGAGTTGGTAAAGAAAATCGAAAGTAAGAACTAA
Protein Properties
Pfam Domain Function
Protein Residues479
Protein Molecular Weight53359.60156
Protein Theoretical pI8.66
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Citrate synthase, mitochondrial MSAILSTTSKSFLSRGSTRQCQNMQKALFALLNARHYSSASEQTLKERFAEIIPAKAEEI KKFKKEHGKTVIGEVLLEQAYGGMRGIKGLVWEGSVLDPEEGIRFRGRTIPEIQRELPKA EGSTEPLPEALFWLLLTGEIPTDAQVKALSADLAARSEIPEHVIQLLDSLPKDLHPMAQF SIAVTALESESKFAKAYAQGVSKKEYWSYTFEDSLDLLGKLPVIASKIYRNVFKDGKITS TDPNADYGKNLAQLLGYENKDFIDLMRLYLTIHSDHEGGNVSAHTTHLVGSALSSPYLSL AAGLNGLAGPLHGRANQEVLEWLFKLREEVKGDYSKETIEKYLWDTLNAGRVVPGYGHAV LRKTDPRYTAQREFALKHFPDYELFKLVSTIYEVAPGVLTKHGKTKNPWPNVDSHSGVLL QYYGLTEASFYTVLFGVARAIGVLPQLIIDRAVGAPIERPKSFSTEKYKELVKKIESKN
References
External Links
ResourceLink
Saccharomyces Genome Database CIT1
Uniprot IDP00890
Uniprot NameCISY1_YEAST
GenBank Gene IDX77395
Genebank Protein ID496718
General Reference
  • Suissa, M., Suda, K., Schatz, G. (1984). "Isolation of the nuclear yeast genes for citrate synthase and fifteen other mitochondrial proteins by a new screening method." EMBO J 3:1773-1781.6090126
  • Lalo, D., Stettler, S., Mariotte, S., Gendreau, E., Thuriaux, P. (1994). "Organization of the centromeric region of chromosome XIV in Saccharomyces cerevisiae." Yeast 10:523-533.7941739
  • Verhasselt, P., Aert, R., Voet, M., Volckaert, G. (1994). "Twelve open reading frames revealed in the 23.6 kb segment flanking the centromere on the Saccharomyces cerevisiae chromosome XIV right arm." Yeast 10:1355-1361.7900425
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169