You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlucose-6-phosphate 1-epimerase
Synonyms
  • D-hexose-6-phosphate mutarotase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in isomerase activity
Specific FunctionCatalyzes the interconversion between the alpha and beta anomers from at least three hexose 6-phosphate sugars (Glc6P, Gal6P, and Man6P)
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Glycolysis / Gluconeogenesisec00010 Map00010
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00311Beta-D-Glucose 6-phosphateShow
YMDB00947Glucose 6-phosphateShow
GO Classification
Component
Not Available
Function
binding
carbohydrate binding
isomerase activity
catalytic activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYMR099C
Gene Sequence>894 bp ATGACTGGAGAAGACTTTAAGATCAAGAGTGGTCTCGCCCAAATGTTAAAAGGTGGCGTT ATTATGGATGTTGTTACTCCAGAGCAGGCAAAAATAGCTGAAAAATCTGGTGCATGTGCG GTAATGGCATTAGAATCCATCCCAGCAGATATGCGTAAGTCAGGAAAGGTTTGCCGCATG TCAGATCCGAAGATGATTAAGGACATCATGAACTCCGTTTCCATTCCCGTCATGGCTAAG GTAAGGATTGGCCATTTTGTTGAAGCTCAAATTATTGAGGCATTGGAAGTTGACTATATT GACGAAAGTGAAGTCTTGACTCCTGCTGATTGGACTCACCACATTGAAAAGGACAAATTC AAAGTTCCATTTGTTTGTGGCGCTAAAGACTTAGGTGAAGCTTTGAGAAGAATTAATGAA GGCGCCGCTATGATTCGTACCAAGGGTGAAGCTGGAACGGGCGATGTCTCTGAAGCCGTC AAGCATATAAGGAGAATTACAGAGGAGATAAAGGCGTGCCAACAATTGAAGAGCGAAGAT GACATTGCAAAAGTTGCTGAGGAAATGAGGGTACCAGTTTCTTTGCTGAAAGATGTTTTA GAAAAAGGTAAGTTGCCAGTAGTAAATTTTGCTGCAGGTGGTGTAGCAACGCCAGCCGAT GCCGCATTGTTAATGCAGTTGGGTTGTGATGGTGTGTTTGTTGGCTCAGGAATTTTTAAA TCATCTAATCCTGTAAGGTTGGCCACTGCAGTAGTAGAGGCTACCACTCACTTTGACAAT CCCAGCAAATTGTTGGAAGTATCTAGTGACTTAGGAGAGTTAATGGGTGGTGTATCAATC GAATCTATTAGTCATGCTTCCAATGGAGTAAGACTTTCCGAAATTGGGTGGTGA
Protein Properties
Pfam Domain Function
Protein Residues297
Protein Molecular Weight33955.69922
Protein Theoretical pI6.05
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glucose-6-phosphate 1-epimerase MPIKETDKEVVLTHPADETTSVHILKYGATVYSWKLKSEEQLWLSTAAKLDGSKPVRGGI PLVFPVFGKNSTDEHLSKLPQHGLARNSTWEFLGQTKENPPTVQFGLKPEIANPELTKLW PMDYLLILTVELGSDYLKTAIEVENTSSSKELKFNWLFHTYFRIEDIEGTMVSNLAGMKL YDQLLKESYVDKHPVVTFNQETDVIYQNVSAERAIQIVDKGVQIHTLKRYNLPDTVVWNP WIEKSQGMADFEPKTGYQQMICIEPGHVHDFISLAPGKKWNAYQLLCKEELKYQAIQ
References
External Links
ResourceLink
Saccharomyces Genome Database YMR099C
Uniprot IDQ03161
Uniprot NameYMY9_YEAST
GenBank Gene IDZ49807
Genebank Protein ID854433
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Graille, M., Baltaze, J. P., Leulliot, N., Liger, D., Quevillon-Cheruel, S., van Tilbeurgh, H. (2006). "Structure-based functional annotation: yeast ymr099c codes for a D-hexose-6-phosphate mutarotase." J Biol Chem 281:30175-30185.16857670