You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative pyridoxal kinase BUD17
Synonyms
  • Bud site selection protein 17
Gene NameBUD17
Enzyme Class
Biological Properties
General FunctionInvolved in pyridoxal kinase activity
Specific FunctionRequired for synthesis of pyridoxal-5-phosphate from vitamin B6. Important for bud site selection
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Vitamin B6 metabolismec00750 Map00750
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00363Pyridoxal 5'-phosphateShow
YMDB00392PyridoxalShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
kinase activity
pyridoxal kinase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
small molecule metabolic process
vitamin metabolic process
water-soluble vitamin metabolic process
vitamin B6 metabolic process
pyridoxine metabolic process
pyridoxine biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNR027W
Gene Sequence>954 bp ATGACCAGTACATTACATACGACAAAAAAAGTGCTCTCCATTCAATCACACGTCATACAT GGCTACGTGGGAAACAAGGCCGCTACGTTCCCACTTCAATACAGAGGTTGGGATGTGGAC GTATTGAACACAGTTCAGTTTTCTAACCACTCGGGGTACGCCCACTTCACAGGCTTCAAA TGCAGCACTGAGGAGTTGGTAGACATTGTAGAGAAGGGCTTGATTGGGTCTCTTAGAATC AAGTATGATGCCGTACTTAGTGGCTATTTACCCAATGGTCAAGCCCTGCAAAAGGTAGCA GGAATAGTGGGTCAATTATGTGAGGGGAGTGAAAACGTCAAGTGGATATTAGATCCTGTA CTGGGCGATAATGGAAGGCTGTACGTGGATCGAGAATGTGTTGCGGTATACCAAGACATT TTACAAAACTTCAAAATTTTTTTGGCCACACCAAATCAGTTTGAAATGGAACTGTTGGTG GGGATGTCAATTCGTACCTTAGACGACGCTAAGCAGGCATTTAAACTATTTCATAAAAAG TACCCTCGAGTAAGCCGAATAGTTGTCACTAGTCTGGAATTATCTGAATTCCTGAGCAAC GACACTTACGTAGTAGCAGGGTTTGATTGCTCGGCCAGTGAAGAGATATTCTTCTATGAA ATCCCCAAGATCAACGCAAAATTTAGTGGAAGTGGTGATTTAATCAGCGCCATGCTCACT GACTCGTTACTAGGCGACCGCCGCTGCACACAGCTGTCATTAAGCGCATCCTTGGGCCAA GTGCTGTGGCTCGTCACCAGTATCCTACAAAAAACGTATGATTTAAACATAGCTGAGCGG GGCCCACAAGATTCCACGATAGATATCAAGGATTTAAAGCTGATTCAGTGTAGAGACATC CTAAAGCAAGATCTCATACCCTCCATTGGCAAGCCAAAAACCATTAAAATATGA
Protein Properties
Pfam Domain Function
Protein Residues317
Protein Molecular Weight35366.5
Protein Theoretical pI6.78
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative pyridoxal kinase BUD17 MTSTLHTTKKVLSIQSHVIHGYVGNKAATFPLQYRGWDVDVLNTVQFSNHSGYAHFTGFK CSTEELVDIVEKGLIGSLRIKYDAVLSGYLPNVQALQKVAGIVGQLCEGSENVKWILDPV LGDNGRLYVDRECVAVYQDILQNFKIFLATPNQFEMELLVGMSIRTLDDAKQAFKLFHKK YPRVSRIVVTSLELSEFLSNDTYVVAGFDCSASEEIFFYEIPKINAKFSGSGDLISAMLT DSLLGDRRCTQLSLSASLGQVLWLVTSILQKTYDLNIAERGPQDSTIDIKDLKLIQCRDI LKQDLIPSIGKPKTIKI
References
External Links
ResourceLink
Saccharomyces Genome Database BUD17
Uniprot IDP53727
Uniprot NameBUD17_YEAST
GenBank Gene IDAY692946
Genebank Protein ID51013343
General Reference
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Ni, L., Snyder, M. (2001). "A genomic study of the bipolar bud site selection pattern in Saccharomyces cerevisiae." Mol Biol Cell 12:2147-2170.11452010
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106