You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUroporphyrinogen decarboxylase
Synonyms
  • UPD
  • URO-D
Gene NameHEM12
Enzyme Class
Biological Properties
General FunctionInvolved in uroporphyrinogen decarboxylase activity
Specific FunctionCatalyzes the decarboxylation of four acetate groups of uroporphyrinogen-III to yield coproporphyrinogen-III
Cellular LocationNucleus. Cytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Porphyrin and chlorophyll metabolismec00860 Map00860
SMPDB ReactionsNot Available
KEGG Reactions
Uroporphyrinogen III + hydronCoproporphyrinogen III + Carbon dioxide
Metabolites
YMDB IDNameView
YMDB00084Coproporphyrinogen IIIShow
YMDB00267Uroporphyrinogen IIIShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
uroporphyrinogen decarboxylase activity
catalytic activity
lyase activity
carbon-carbon lyase activity
carboxy-lyase activity
Process
metabolic process
nitrogen compound metabolic process
tetrapyrrole metabolic process
porphyrin metabolic process
porphyrin biosynthetic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR047W
Gene Sequence>1089 bp ATGGGTAACTTTCCAGCTCCAAAAAACGATTTGATATTGAGAGCCGCAAAGGGTGAAAAA GTCGAGAGACCGCCATGCTGGATAATGCGCCAGGCAGGTCGTTACCTGCCGGAATATCAC GAGGTGAAAAACAATCGTGATTTCTTTCAAACTTGCAGGGATGCGGAAATTGCTTCTGAG ATTACTATCCAGCCGGTAAGACGCTATAGAGGCCTCATTGATGCTGCTATTATTTTTAGT GATATCTTAGTTATTCCGCAAGCCATGGGTATGAGGGTCGAGATGCTCGAAGGTAAAGGT CCACATTTCCCAGAACCTTTAAGAAATCCGGAAGACCTCCAAACGGTATTAGACTACAAG GTTGATGTTTTGAAAGAGTTAGATTGGGCTTTCAAGGCAATCACCATGACAAGGATCAAG TTGGATGGTGAGGTTCCCTTATTTGGCTTTTGCGGGGGACCTTGGACTCTAATGGTTTAT ATGACGGAAGGCGGTGGATCCCGTCTTTTCAGATTTGCCAAACAATGGATTAACATGTAT CCAGAGCTTTCTCACAAATTATTACAAAAAATCACTGATGTGGCCGTGGAGTTTCTGAGT CAGCAAGTCGTGGCGGGTGCTCAAATACTACAAGTTTTTGAAAGTTGGGGTGGTGAGCTT TCGTCTGTAGATTTTGATGAGTTTTCCCTACCATATTTAAGACAAATTGCCGAAAGAGTG CCTAAAAGATTGCAAGAATTAGGTATCATGGAACAGATTCCTATGATCGTTTTTGCGAAA GGGTCGTGGTATGCTTTGGACAAGCTATGCTGTTCAGGATTTGACGTTGTTTCGTTGGAC TGGTCCTGGGACCCAAGAGAAGCGGTAAAAATAAACAAGAACCGTGTCACCTTGCAGGGC AACCTGGATCCTGGCGTCATGTATGGTTCTAAAGAGGTAATAACAAAGAAAGTTAAACAG ATGATTGAGGCTTTTGGAGGTGGGAAGTCCCGCTACATTGTTAATTTCGGTCACGGTACC CACCCTTTCATGGATCCAGACGTCATCAAGTTTTTCTTGGAGGAGTGCCACAGAATTGGT TCGAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues362
Protein Molecular Weight41348.69922
Protein Theoretical pI7.09
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Uroporphyrinogen decarboxylase MGNFPAPKNDLILRAAKGEKVERPPCWIMRQAGRYLPEYHEVKNNRDFFQTCRDAEIASE ITIQPVRRYRGLIDAAIIFSDILVIPQAMGMRVEMLEGKGPHFPEPLRNPEDLQTVLDYK VDVLKELDWAFKAITMTRIKLDGEVPLFGFCGGPWTLMVYMTEGGGSRLFRFAKQWINMY PELSHKLLQKITDVAVEFLSQQVVAGAQILQVFESWGGELSSVDFDEFSLPYLRQIAERV PKRLQELGIMEQIPMIVFAKGSWYALDKLCCSGFDVVSLDWSWDPREAVKINKNRVTLQG NLDPGVMYGSKEVITKKVKQMIEAFGGGKSRYIVNFGHGTHPFMDPDVIKFFLEECHRIG SK
References
External Links
ResourceLink
Saccharomyces Genome Database HEM12
Uniprot IDP32347
Uniprot NameDCUP_YEAST
GenBank Gene IDX63721
Genebank Protein ID3767
General Reference
  • Garey, J. R., Labbe-Bois, R., Chelstowska, A., Rytka, J., Harrison, L., Kushner, J., Labbe, P. (1992). "Uroporphyrinogen decarboxylase in Saccharomyces cerevisiae. HEM12 gene sequence and evidence for two conserved glycines essential for enzymatic activity." Eur J Biochem 205:1011-1016.1576986
  • Diflumeri, C., Larocque, R., Keng, T. (1993). "Molecular analysis of HEM6 (HEM12) in Saccharomyces cerevisiae, the gene for uroporphyrinogen decarboxylase." Yeast 9:613-623.8346678
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Chelstowska, A., Zoladek, T., Garey, J., Kushner, J., Rytka, J., Labbe-Bois, R. (1992). "Identification of amino acid changes affecting yeast uroporphyrinogen decarboxylase activity by sequence analysis of hem12 mutant alleles." Biochem J 288 ( Pt 3):753-757.1471989
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106