You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRepressible acid phosphatase
Synonyms
  • P60
Gene NamePHO5
Enzyme Class
Biological Properties
General FunctionInvolved in acid phosphatase activity
Specific FunctionPartially mediates extracellular nucleotide derived phosphate hydrolysis along with NPP1 and NPP2
Cellular LocationSecreted
SMPDB Pathways
Riboflavin metabolismPW002443 ThumbThumb?image type=greyscaleThumb?image type=simple
Vitamin B1/Thiamine metabolismPW002486 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Riboflavin metabolismec00740 Map00740
SMPDB Reactions
Thiamine monophosphate + waterThiamine + phosphate
KEGG Reactions
Flavin Mononucleotide + water Riboflavin + phosphate
Metabolites
YMDB IDNameView
YMDB00085Flavin MononucleotideShow
YMDB00164Thiamine monophosphateShow
YMDB00220ThiamineShow
YMDB00534RiboflavinShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
acid phosphatase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 2
LocusYBR093C
Gene Sequence>1404 bp ATGTTTAAATCTGTTGTTTATTCAATTTTAGCCGCTTCTTTGGCCAATGCAGGTACCATT CCCTTAGGCAAACTAGCCGATGTCGACAAGATTGGTACCCAAAAATATATCTTCCCATTT TTGGGTGGTGCCGGACCATACTACTCTTTCCCTGGCGACTATGGTATTTCTCGTGATTTG CCTGAAGGTTGTGAAATGAAGCAACTGCAAATGGTTGGTAGGCATGGTGAAAGATACCCT ACTGTCAGTCTGGCTAAGACTATCAAGAGTACATGGTATAAGTTGAGCAATTACACTCGT CAATTCAACGGCTCATTGTCATTCTTGAACGATGATTACGAGTTTTTCATCCGTGATGAC GATGATTTGGAAATGGAAACCACTTTTGGGAACTCGGACGATGTTTTGAACCCATACACT GGTGAAATGAACGCCAAGAGACATGCTCGTGACTTCTTGGCTCAATACGGTTACATGGTC GAAAACCAAACCAGTTTCGCCGTTTTTACCTCTAATTCTAAGAGATGTCATGACACTGCT CAATATTTCATTGATGGTTTAGGTGACCAATTCAACATCACCTTGCAGACTGTCAGTGAA GCTGAATCCGCTGGTGCCAACACTTTGAGTGCTTGTAACTCATGTCCTGCCTGGGACTAC GATGCCAATGATGACATTGTAAATGAATACGACACAACCTACTTGGATGACATTGCCAAG AGATTGAACAAGGAAAACAAGGGTTTGAACTTGACCTCAACTGACGCTAGTACTTTATTC TCGTGGTGTGCATTTGAAGTGAACGCCAAAGGTTACAGTGATGTCTGTGATATTTTCACC AAGGATGAATTAGTCCATTACTCCTACTACCAAGACTTGCAGACCTATTACCATGAAGGT CCAGGTTACGATATTATCAAGTCTGTCGGTTCCAACTTGTTCAATGCCTCAGTCAAATTA TTAAAGCAAAGTGAGATTCAAGACCAAAAGGTTTGGTTGAGTTTTACCCACGATACCGAT ATCCTAAACTTTTTGACCACCGCTGGTATAATTGACGACAAAAACAACTTAACTGCCGAA TACGTTCCATTCATGGGCAACACTTTCCACAGATCCTGGTACGTTCCTCAAGGTGCTCGT GTCTACACCGAAAAATTCCAATGTTCTAACGACACCTACGTCAGATACGTCATTAACGAT GCTGTCGTTCCAATTGAAACCTGTTCCACTGGTCCAGGGTTCTCTTGTGAAATCAATGAC TTCTACGACTATGCTGAAAAGAGAGTAGCCGGTACTGACTTCCTAAAGGTCTGTAACGTC AGCAGTGTCAGTAACGTCACCGAATTGACCTTCTACTGGGACTGGAATACTACTCACTAC AATGATACCCTATTAAAACAATAA
Protein Properties
Pfam Domain Function
Protein Residues467
Protein Molecular Weight52858.10156
Protein Theoretical pI4.41
Signalling Regions
  • 1-17
Transmembrane Regions
  • None
Protein Sequence>Repressible acid phosphatase MFKSVVYSILAASLANAGTIPLGKLADVDKIGTQKDIFPFLGGAGPYYSFPGDYGISRDL PEGCEMKQLQMVGRHGERYPTVSLAKTIKSTWYKLSNYTRQFNGSLSFLNDDYEFFIRDD DDLEMETTFANSDDVLNPYTGEMNAKRHARDFLAQYGYMVENQTSFAVFTSNSKRCHDTA QYFIDGLGDQFNITLQTVSEAESAGANTLSACNSCPAWDYDANDDIVNEYDTTYLDDIAK RLNKENKGLNLTSTDASTLFSWCAFEVNAKGYSDVCDIFTKDELVHYSYYQDLHTYYHEG PGYDIIKSVGSNLFNASVKLLKQSEIQDQKVWLSFTHDTDILNFLTTAGIIDDKNNLTAE YVPFMGNTFHRSWYVPQGARVYTEKFQCSNDTYVRYVINDAVVPIETCSTGPGFSCEIND FYDYAEKRVAGTDFLKVCNVSSVSNSTELTFYWDWNTTHYNASLLRQ
References
External Links
ResourceLink
Saccharomyces Genome Database PHO5
Uniprot IDP00635
Uniprot NamePPA5_YEAST
GenBank Gene IDV01320
Genebank Protein ID4159
General Reference
  • Arima, K., Oshima, T., Kubota, I., Nakamura, N., Mizunaga, T., Toh-e, A. (1983). "The nucleotide sequence of the yeast PHO5 gene: a putative precursor of repressible acid phosphatase contains a signal peptide." Nucleic Acids Res 11:1657-1672.6300772
  • Bajwa, W., Meyhack, B., Rudolph, H., Schweingruber, A. M., Hinnen, A. (1984). "Structural analysis of the two tandemly repeated acid phosphatase genes in yeast." Nucleic Acids Res 12:7721-7739.6093051
  • Mannhaupt, G., Stucka, R., Ehnle, S., Vetter, I., Feldmann, H. (1994). "Analysis of a 70 kb region on the right arm of yeast chromosome II." Yeast 10:1363-1381.7900426
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Tait-Kamradt, A. G., Turner, K. J., Kramer, R. A., Elliott, Q. D., Bostian, S. J., Thill, G. P., Rogers, D. T., Bostian, K. A. (1986). "Reciprocal regulation of the tandemly duplicated PHO5/PHO3 gene cluster within the acid phosphatase multigene family of Saccharomyces cerevisiae." Mol Cell Biol 6:1855-1865.3537710
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kennedy, E. J., Pillus, L., Ghosh, G. (2005). "Pho5p and newly identified nucleotide pyrophosphatases/ phosphodiesterases regulate extracellular nucleotide phosphate metabolism in Saccharomyces cerevisiae." Eukaryot Cell 4:1892-1901.16278456