| Identification |
|---|
| Name | Mitochondrial distribution and morphology protein 35 |
|---|
| Synonyms | Not Available |
|---|
| Gene Name | MDM35 |
|---|
| Enzyme Class | Not Available |
|---|
| Biological Properties |
|---|
| General Function | protein targeting to mitochondrion |
|---|
| Specific Function | Involved in mitochondrial distribution and morphology. Mediates the import of UPS1, UPS2 and UPS3, 3 atypical mitochondrial intermembrane space (IMS) proteins lacking the two major IMS-targeting signals, into the intermembrane space. The UPS1:MDM35 complex mediates the transfer of phosphatidic acid (PA) between liposomes and probably functions as a PA transporter across the mitochondrion intermembrane space (PubMed:26071602, PubMed:26071601, PubMed:26235513). Phosphatidic acid import is required for cardiolipin (CL) synthesis in the mitochondrial inner membrane (PubMed:26071602). |
|---|
| Cellular Location | Not Available |
|---|
| SMPDB Pathways | | Cardiolipin Biosynthesis CL(10:0/14:0/18:0/22:1(9Z)) | PW004139 |    | | Cardiolipin Biosynthesis CL(10:0/14:0/18:0/24:0) | PW004140 |    | | Cardiolipin Biosynthesis CL(10:0/14:0/18:0/24:1(11Z)) | PW004141 |    | | Cardiolipin Biosynthesis CL(10:0/14:0/18:0/24:1(9Z)) | PW004142 |    | | Cardiolipin Biosynthesis CL(10:0/14:0/18:0/26:0) | PW004143 |    |
|
|---|
| KEGG Pathways | Not Available |
|---|
| SMPDB Reactions | Not Available |
|---|
| KEGG Reactions | Not Available |
|---|
| Metabolites | |
|---|
| GO Classification | | Function |
|---|
| mitochondrial intermembrane space | | nucleus | | lipid transport | | mitochondrial respiratory chain complex assembly | | mitochondrion organization | | protein targeting to mitochondrion |
|
|---|
| Gene Properties |
|---|
| Chromosome Location | Not Available |
|---|
| Locus | |
|---|
| Gene Sequence | >261 bp
ATGGGGAATATAATGTCAGCTAGTTTTGCGCCTGAATGCACTGACCTGAAGACGAAATAC
GATAGTTGTTTTAATGAATGGTATAGCGAAAAATTCCTGAAGGGAAAATCCGTTGAGAAC
GAGTGCTCAAAACAATGGTACGCTTATACTACATGTGTCAACGCAGCTCTCGTCAAACAA
GGTATTAAGCCTGCTCTAGACGAAGCTAGGGAGGAGGCGCCGTTTGAAAATGGCGGCAAA
CTAAAAGAAGTTGACAAATGA |
|---|
| Protein Properties |
|---|
| Pfam Domain Function | Not Available |
|---|
| Protein Residues | 86 |
|---|
| Protein Molecular Weight | 9711.885 |
|---|
| Protein Theoretical pI | Not Available |
|---|
| PDB File | show |
|---|
| Signalling Regions | Not Available |
|---|
| Transmembrane Regions | Not Available |
|---|
| Protein Sequence | >Mitochondrial distribution and morphology protein 35
MGNIMSASFAPECTDLKTKYDSCFNEWYSEKFLKGKSVENECSKQWYAYTTCVNAALVKQ
GIKPALDEAREEAPFENGGKLKEVDK |
|---|
| References |
|---|
| External Links | |
|---|
| General Reference | Not Available |
|---|