You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHomocysteine S-methyltransferase 1
Synonyms
  • S-methylmethionine:homocysteine methyltransferase 1
  • SMM:Hcy S-methyltransferase 1
Gene NameMHT1
Enzyme Class
Biological Properties
General FunctionInvolved in homocysteine S-methyltransferase activity
Specific FunctionHomocysteine S-methyltransferase involved in the conversion of S-adenosylmethionine (AdoMet) to methionine to control the methionine/AdoMet ratio. Converts also S- methylmethionine (SMM) to methionine
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
SMPDB ReactionsNot Available
KEGG Reactions
L-Homocysteine + S-AdenosylmethionineL-Methionine + S-Adenosylhomocysteine + hydron
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00318L-MethionineShow
YMDB00347S-Methyl-L-methionineShow
YMDB00371HomocysteineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00520L-HomocysteineShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
homocysteine S-methyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
S-methyltransferase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 12
LocusYLL062C
Gene Sequence>975 bp ATGAAGCGCATTCCAATCAAAGAACTAATAGTTGAGCACCCCGGAAAAGTTCTTATCCTT GATGGTGGACAGGGTACAGAATTGGAAAACAGAGGCATTAACATAAATAGTCCGGTATGG TCTGCAGCTCCTTTTACGAGCGAATCCTTTTGGGAGCCATCTTCTCAAGAGCGAAAGGTG GTAGAAGAAATGTACAGAGACTTTATGATTGCTGGCGCAAACATATTAATGACAATTACT TACCAGGCAAACTTTCAAAGCATATCTGAGAATACCTCGATTAAAACTCTGGCTGCTTAC AAGCGTTTTCTCGATAAAATCGTGTCATTTACTCGTGAATTTATTGGTGAGGAAAGGTAC TTAATCGGGAGTATTGGCCCATGGGCAGCACATGTATCCTGTGAATATACTGGTGACTAT GGTCCCCATCCTGAGAATATTGATTACTACGGCTTTTTCAAACCCCAGCTGGAGAACTTC AACCAAAATAGAGATATTGATCTTATTGGTTTTGAAACGATTCCAAATTTTCATGAGTTA AAGGCTATTTTATCCTGGGATGAAGATATTATTTCGAAGCCCTTTTATATTGGGTTGTCG GTGGATGACAATAGTTTGCTACGAGACGGTACCACTTTGGAAGAAATTTCTGTCCATATA AAAGGCCTCGGAAATAAAATTAACAAGAATCTCTTATTAATGGGAGTTAACTGTGTCAGT TTCAATCAATCGGCATTAATTCTTAAAATGTTGCACGAGCATCTACCTGGCATGCCTCTG CTAGTTTACCCAAACAGTGGAGAAATCTACAATCCCAAAGAGAAGACATGGCACCGGCCG ACTAATAAGTTGGATGACTGGGAGACCACGGTTAAGAAATTCGTTGATAATGGTGCGCGC ATTATTGGCGGTTGTTGTAGAACGTCTCCTAAAGATATCGCCGAAATTGCATCAGCTGTA GATAAATACTCCTAA
Protein Properties
Pfam Domain Function
Protein Residues324
Protein Molecular Weight36714.5
Protein Theoretical pI5.26
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Homocysteine S-methyltransferase 1 MKRIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFWEPSSQERKV VEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEERY LIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHEL KAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCVS FNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDNGAR IIGGCCRTSPKDIAEIASAVDKYS
References
External Links
ResourceLink
Saccharomyces Genome Database MHT1
Uniprot IDQ12525
Uniprot NameMHT1_YEAST
GenBank Gene IDAY558194
Genebank Protein ID45270278
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Thomas, D., Becker, A., Surdin-Kerjan, Y. (2000). "Reverse methionine biosynthesis from S-adenosylmethionine in eukaryotic cells." J Biol Chem 275:40718-40724.11013242
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106