You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative uncharacterized hydrolase YOR131C
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionNot Available
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00073Glycerol 3-phosphateShow
YMDB00283GlycerolShow
YMDB00807glycolic acidShow
YMDB00858Phosphoglycolic acidShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00989glycerol 1-phosphateShow
YMDB00994glycerol 2-phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
phosphoglycolate phosphatase activity
Process
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYOR131C
Gene Sequence>657 bp ATGACAAAGCTACAAGGACTACAGGGATTAAAACACATCAAAGCGGTTGTATTTGATATG GATGGCACATTATGCCTACCCCAGCCTTGGATGTTTCCAGCAATGAGAAACGCCATAGGA TTGGAGGACAAATCGATTGATATCCTTCATTTCATTGATACATTGCCCACAGAAAAAGAA AAAAAAGAAGCGCATGATAGAATAGAATTAGTTGAGGCAAAAGCCATGAAGGAGATGCAA CCGCAGCCTGGTCTGGTTGACATAATGAGGTATTTGACGAAAAATGGTATTAGCAAGAAC ATATGTACTAGAAATGTCGGAGCCCCGGTAGAGACTTTTGTTAAAAGATTTATTCCATCC GAGCTTTCGAGGTTTGACTATATTGTGACAAGGGAGTTTAGGCCTACAAAACCGCAACCA GACCCATTATTACACATCGCCTCGAAGCTAAATATAAGGCCCTTGGAAATGATCATGGTA GGAGATTCATTTGACGACATGAAATCCGGTAGATCTGCTGGATGTTTCACGGTATTACTC AAGAATCATGTGAATGGACATTTACTGCTCGAACATAAAGAACTAGTAGACGTTTCAGTA GAGGATCTTTCCGAAATAATTGAATTGATTCAAAATATGAATAAAGAAAGTTTCTAA
Protein Properties
Pfam Domain Function
Protein Residues218
Protein Molecular Weight24839.80078
Protein Theoretical pI6.63
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative uncharacterized hydrolase YOR131C MTKLQGLQGLKHIKAVVFDMDGTLCLPQPWMFPAMRNAIGLEDKSIDILHFIDTLPTEKE KKEAHDRIELVEAKAMKEMQPQPGLVDIMRYLTKNGISKNICTRNVGAPVETFVKRFIPS ELSRFDYIVTREFRPTKPQPDPLLHIASKLNIRPLEMIMVGDSFDDMKSGRSAGCFTVLL KNHVNGHLLLEHKELVDVSVEDLSEIIELIQNMNKESF
References
External Links
ResourceLink
Saccharomyces Genome Database YOR131C
Uniprot IDQ12486
Uniprot NameYOR31_YEAST
GenBank Gene IDX90518
Genebank Protein ID1050822
General Reference
  • Wiemann, S., Rechmann, S., Benes, V., Voss, H., Schwager, C., Vlcek, C., Stegemann, J., Zimmermann, J., Erfle, H., Paces, V., Ansorge, W. (1996). "Sequencing and analysis of 51 kb on the right arm of chromosome XV from Saccharomyces cerevisiae reveals 30 open reading frames." Yeast 12:281-288.8904341
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Voss, H., Benes, V., Andrade, M. A., Valencia, A., Rechmann, S., Teodoru, C., Schwager, C., Paces, V., Sander, C., Ansorge, W. (1997). "DNA sequencing and analysis of 130 kb from yeast chromosome XV." Yeast 13:655-672.9200815
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874