You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative reductase 1
SynonymsNot Available
Gene NameYPR1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionNot Available
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
D-glyceraldehyde + NADPH + hydronNADP + Glycerol
2-Methylbutanal + NADPH + hydronNADP + 2-methylbutan-1-ol
Metabolites
YMDB IDNameView
YMDB00283GlycerolShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB004852-MethylbutanalShow
YMDB005672-methylbutan-1-olShow
YMDB00575D-glyceraldehydeShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
oxidoreductase activity
catalytic activity
Process
oxidation reduction
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR368W
Gene Sequence>939 bp ATGCCTGCTACGTTAAAGAATTCTTCTGCTACATTAAAACTAAATACTGGTGCCTCCATT CCAGTGTTGGGTTTCGGCACTTGGCGTTCCGTTGACAATAACGGTTACCATTCTGTAATT GCAGCTTTGAAAGCTGGATACAGACACATTGATGCTGCGGCTATCTATTTGAATGAAGAA GAAGTTGGCAGGGCTATTAAAGATTCCGGAGTCCCTCGTGAGGAAATTTTTATTACTACT AAGCTTTGGGGTACGGAACAACGTGATCCGGAAGCTGCTCTAAACAAGTCTTTGAAAAGA CTAGGCTTGGATTATGTTGACCTATATCTGATGCATTGGCCAGTGCCTTTGAAAACCGAC AGAGTTACTGATGGTAACGTTCTGTGCATTCCAACATTAGAAGATGGCACTGTTGACATC GATACTAAGGAATGGAATTTTATCAAGACGTGGGAGTTGATGCAAGAGTTGCCAAAGACG GGCAAAACTAAAGCCGTTGGTGTCTCTAATTTTTCTATTAACAACATTAAAGAATTATTA GAATCTCCAAATAACAAGGTGGTACCAGCTACTAATCAAATTGAAATTCATCCATTGCTA CCACAAGACGAATTGATTGCCTTTTGTAAGGAAAAGGGTATTGTTGTTGAAGCCTACTCA CCATTTGGGAGTGCTAATGCTCCTTTACTAAAAGAGCAAGCAATTATTGATATGGCTAAA AAGCACGGCGTTGAGCCAGCACAGCTTATTATCAGTTGGAGTATTCAAAGAGGCTACGTT GTTCTGGCCAAATCGGTTAATCCTGAAAGAATTGTATCCAATTTTAAGATTTTCACTCTG CCTGAGGATGATTTCAAGACTATTAGTAACCTATCCAAAGTGCATGGTACAAAGAGAGTC GTTGATATGAAGTGGGGATCCTTCCCAATTTTCCAATGA
Protein Properties
Pfam Domain Function
Protein Residues312
Protein Molecular Weight34754.69922
Protein Theoretical pI7.15
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative reductase 1 MPATLKNSSATLKLNTGASIPVLGFGTWRSVDNNGYHSVIAALKAGYRHIDAAAIYLNEE EVGRAIKDSGVPREEIFITTKLWGTEQRDPEAALNKSLKRLGLDYVDLYLMHWPVPLKTD RVTDGNVLCIPTLEDGTVDIDTKEWNFIKTWELMQELPKTGKTKAVGVSNFSINNIKELL ESPNNKVVPATNQIEIHPLLPQDELIAFCKEKGIVVEAYSPFGSANAPLLKEQAIIDMAK KHGVEPAQLIISWSIQRGYVVLAKSVNPERIVSNFKIFTLPEDDFKTISNLSKVHGTKRV VDMKWGSFPIFQ
References
External Links
ResourceLink
Saccharomyces Genome Database YPR1
Uniprot IDQ12458
Uniprot NameYPR1_YEAST
GenBank Gene IDU28373
Genebank Protein ID849189
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956