You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCTP-dependent diacylglycerol kinase 1
Synonyms
  • Diglyceride kinase 1
  • DAG kinase 1
  • High-copy suppressor of SLY1 defect protein 1
Gene NameDGK1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transferase activity, transferring phosphorus-containing groups
Specific FunctionInvolved in pre-tRNA splicing. CTP- dependent diacylglycerol kinase that catalyzes the phosphorylation of diacylglycerol (DAG) to phosphatidate (PA). Controls phosphatidate levels at the nuclear envelope. Counteracts the activity of PAH1/SMP2. Involved in the resistance to nickel chloride and nalidixic acid. May be involved in vesicle trafficking between the endoplasmic reticulum and the Golgi apparatus
Cellular LocationEndoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein. Nucleus membrane; Multi-pass membrane protein
SMPDB Pathways
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolismPW002695 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/10:0)PW007514 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/12:0)PW007575 ThumbThumb?image type=greyscaleThumb?image type=simple
Triacylglycerol metabolism TG(10:0/10:0/14:0)PW007576 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
DG(14:0/14:1(9Z)/0:0) + Cytidine triphosphate → PA(14:0/14:1(9Z)) + hydron + CDP
DG(14:1(9Z)/14:1(9Z)/0:0) + Cytidine triphosphate → PA(14:1(9Z)/14:1(9Z)) + hydron + CDP
DG(14:0/15:0/0:0) + Cytidine triphosphate → PA(14:0/15:0) + hydron + CDP
DG(10:0/23:1(9Z)/0:0) + Cytidine triphosphate → PA(10:0/23:1(9Z)) + hydron + CDP
DG(14:0/15:1(9Z)/0:0) + Cytidine triphosphate → PA(14:0/15:1(9Z)) + hydron + CDP
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00064CDPShow
YMDB00279Cytidine triphosphateShow
YMDB00862hydronShow
YMDB01127DG(16:0/16:0/0:0)Show
YMDB01161PA(16:0/16:0)Show
YMDB12737DG(14:0/14:0/0:0)Show
GO Classification
Component
cell part
membrane
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
Not Available
Gene Properties
Chromosome Locationchromosome 15
LocusYOR311C
Gene Sequence>873 bp ATGGGGACCGAAGATGCCATTGCCCTTCCAAATAGCACGCTAGAGCCGCGTACCGAAGCT AAGCAAAGACTATCATCTAAGAGTCATCAAGTCTCGGCGAAAGTAACGATTCCAGCAAAA GAAGAAATTAGTAGTAGCGATGACGATGCACACGTTCCAGTGACAGAAATACATTTGAAA TCTCATGAATGGTTCGGCGATTTTATAACTAAACATGAAATTCCCCGTAAGGTGTTCCAT TCTTCCATTGGCTTTATTACTTTGTACCTGTATACGCAGGGTATTAATTATAAAAATGTT TTATGGCCTTTGATATACGCCTTCATCATATTGTTTATTTTGGATCTGATAAGACTAAAC TGGCCCTTTTTCAATATGCTTTACTGTAGAACTGTGGGTGCGCTAATGAGAAAAAAGGAG ATTCATACATACAATGGGGTATTGTGGTACATTCTTGGGTTAATCTTTTCTTTTAACTTT TTCTCTAAAGATGTTACCTTAATATCGTTATTTTTGCTAAGTTGGTCCGATACAGCCGCC GCAACTATTGGAAGAAAGTATGGTCATTTAACACCCAAAGTGGCAAGAAATAAATCCCTT GCAGGTTCGATAGCTGCGTTTACAGTTGGTGTTATCACCTGCTGGGTATTTTATGGCTAT TTTGTTCCTGCCTACAGCTACGTCAACAAACCTGGCGAGATCCAATGGAGCCCAGAAACA AGCAGATTAAGTTTGAATATGCTATCCTTGTTAGGTGGTGTGGTAGCTGCTTTGAGTGAA GGTATAGATTTGTTCAACTGGGATGATAATTTCACTATTCCTGTCCTGTCATCACTTTTT ATGAACGCAGTAATCAAAACATTCAAGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues290
Protein Molecular Weight32839.80078
Protein Theoretical pI9.15
Signalling Regions
  • None
Transmembrane Regions
  • 78-95
  • 104-124
  • 141-161
  • 164-184
  • 204-224
  • 245-265
Protein Sequence>CTP-dependent diacylglycerol kinase 1 MGTEDAIALPNSTLEPRTEAKQRLSSKSHQVSAKVTIPAKEEISSSDDDAHVPVTEIHLK SHEWFGDFITKHEIPRKVFHSSIGFITLYLYTQGINYKNVLWPLIYAFIILFILDLIRLN WPFFNMLYCRTVGALMRKKEIHTYNGVLWYILGLIFSFNFFSKDVTLISLFLLSWSDTAA ATIGRKYGHLTPKVARNKSLAGSIAAFTVGVITCWVFYGYFVPAYSYVNKPGEIQWSPET SRLSLNMLSLLGGVVAALSEGIDLFNWDDNFTIPVLSSLFMNAVIKTFKK
References
External Links
ResourceLink
Saccharomyces Genome Database DGK1
Uniprot IDQ12382
Uniprot NameDGK1_YEAST
GenBank Gene IDX90565
Genebank Protein ID940842
General Reference
  • Pearson, B. M., Hernando, Y., Payne, J., Wolf, S. S., Kalogeropoulos, A., Schweizer, M. (1996). "Sequencing of a 35.71 kb DNA segment on the right arm of yeast chromosome XV reveals regions of similarity to chromosomes I and XIII." Yeast 12:1021-1031.8896266
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Rieger, K. J., El-Alama, M., Stein, G., Bradshaw, C., Slonimski, P. P., Maundrell, K. (1999). "Chemotyping of yeast mutants using robotics." Yeast 15:973-986.10407277
  • Kosodo, Y., Imai, K., Hirata, A., Noda, Y., Takatsuki, A., Adachi, H., Yoda, K. (2001). "Multicopy suppressors of the sly1 temperature-sensitive mutation in the ER-Golgi vesicular transport in Saccharomyces cerevisiae." Yeast 18:1003-1014.11481671
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Han, G. S., O'Hara, L., Carman, G. M., Siniossoglou, S. (2008). "An unconventional diacylglycerol kinase that regulates phospholipid synthesis and nuclear membrane growth." J Biol Chem 283:20433-20442.18458075
  • Han, G. S., O'Hara, L., Siniossoglou, S., Carman, G. M. (2008). "Characterization of the yeast DGK1-encoded CTP-dependent diacylglycerol kinase." J Biol Chem 283:20443-20453.18458076