You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoglycerate mutase 3
Synonyms
  • PGAM 3
  • BPG-dependent PGAM 3
  • MPGM 3
  • Phosphoglyceromutase 3
Gene NameGPM3
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCould be non-functional
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Glycolysis / Gluconeogenesisec00010 Map00010
Methane metabolismec00680 Map00680
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB003413-Phosphoglyceric acidShow
YMDB006712,3-bisphospho-D-glyceric acidShow
YMDB006752-phospho-D-glyceric acidShow
YMDB007563-phospho-D-glyceric acidShow
YMDB009852-phospho-d-glycerateShow
GO Classification
Component
Not Available
Function
catalytic activity
isomerase activity
intramolecular transferase activity
intramolecular transferase activity, phosphotransferases
Process
metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
Gene Properties
Chromosome Locationchromosome 15
LocusYOL056W
Gene Sequence>912 bp ATGACTGTTACTGACACTTTTAAACTGTTTATTTTAAGGCATGGTCAAAGTGAATTAAAC TCAGAAAACATATTCTGCGGATGGATTGATGCTCAATTAACGGAAAAAGGGAAGTCTCAG GCCCGCCACTCTGCAAAATTGATCAAGCAGTTTTGCGATTCTAACAATATCTCTTTGCCT CAGATTGGCTATACTTCAAGGTTGATTCGAACTCAGCAGACCATGGACGTTATTCTCGAA GAGTTGGGACTAAAACACACCAATTATGTAATTACTACGAATACAAACATTAAGGAGGAG CTGCAGGACACAAGATTTGAAGGAAGTATGCCTGTGTTGCAAACCTGGAGGTTAAATGAG CGTCATTACGGCGCATGGCAAGGACAAAGAAAGCCAGATATCTTGAAAGAATACGGTAAG GAAAAATACATGTATATCAGAAGAGATTACAACGGAAAACCCCCTAAAGTCAACCTAAAC CTGGAAATGGTCCAAGAGGAAAATGATCAGGGGTCCTCCACAGGCTATGATTTTAAGGAG CCCAATAGACACTTAAAATACGGCCCCGAAGAGAAGGCTAATGAGCGTCTGCCAGAAAGT GAGTCTCTTTGTGAAGTGGTCGTCAGATTGAAACCATTTTTAAATAATGTTGTTCTGTCT ACCGCCAACAAAATCAGTCAAGAATCGTGTGTTATAGTTGGGCATGGCAGCTCTGTAAGA TCTCTGCTGAAAGTATTGGAAGGTATCTCAGATGAAGACATCAAAGATGTCGATATTCCC AACGGCATTCCGCTAGTTATAGAGTTGGATAGAGACAATTACTCTTTTGTGAGGAAATTT TACTTGGATCCAGAATCAGCTAAAGTTAATGCTCAAATGGTTCGTGATGAGGGTTTCGAA AAGAATCCATGA
Protein Properties
Pfam Domain Function
Protein Residues303
Protein Molecular Weight34863.19922
Protein Theoretical pI6.01
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoglycerate mutase 3 MTVTDTFKLFILRHGQSELNSENIFCGWIDAQLTEKGKSQARHSAKLIKQFCDSNNISLP QIGYTSRLIRTQQTMDVILEELGLKHTNYVITTNTNIKEELQDTRFEGSMPVLQTWRLNE RHYGAWQGQRKPDILKEYGKEKYMYIRRDYNGKPPKVNLNLEMVQEENDQGSSTGYDFKE PNRHLKYGPEEKANERLPESESLCEVVVRLKPFLNNVVLSTANKISQESCVIVGHGSSVR SLLKVLEGISDEDIKDVDIPNGIPLVIELDRDNYSFVRKFYLDPESAKVNAQMVRDEGFE KNP
References
External Links
ResourceLink
Saccharomyces Genome Database GPM3
Uniprot IDQ12326
Uniprot NamePMG3_YEAST
GenBank Gene IDX91067
Genebank Protein ID984186
General Reference
  • Mannhaupt, G., Vetter, I., Schwarzlose, C., Mitzel, S., Feldmann, H. (1996). "Analysis of a 26 kb region on the left arm of yeast chromosome XV." Yeast 12:67-76.8789261
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Heinisch, J. J., Muller, S., Schluter, E., Jacoby, J., Rodicio, R. (1998). "Investigation of two yeast genes encoding putative isoenzymes of phosphoglycerate mutase." Yeast 14:203-213.9544241
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106