You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHydroxyacylglutathione hydrolase, mitochondrial
Synonyms
  • Glyoxalase II
  • Glx II
Gene NameGLO4
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity
Specific FunctionThiolesterase that catalyzes the hydrolysis of S-D- lactoyl-glutathione to form glutathione and D-lactic acid
Cellular LocationMitochondrion matrix
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
S-Lactoylglutathione + waterGlutathione + D-Lactic acid
KEGG Reactions
S-Lactoylglutathione + waterGlutathione + hydron + D-Lactic acid
Metabolites
YMDB IDNameView
YMDB00160GlutathioneShow
YMDB00246S-LactoylglutathioneShow
YMDB00287D-Lactic acidShow
YMDB00862hydronShow
YMDB00880S-D-LactoylglutathioneShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity
catalytic activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 15
LocusYOR040W
Gene Sequence>858 bp ATGAAGTTTTTACTGCAGCAAATAAGAAATATGCATGTTAAGCCTATAAAAATGCGATGG TTGACAGGTGGTGTCAATTATAGTTATTTACTAAGCACTGAAGACAGGAGAAACTCATGG CTGATTGACCCTGCAGAACCACTTGAGGTGTCGCCAAAATTAAGCGCCGAAGAGAAAAAA AGTATTGATGCTATTGTCAATACACATCACCATTATGACCATTCGGGGGGGAACCTAGCG CTTTATAGTATCTTGTGCCAAGAAAACTCAGGTCACGATATTAAAATAATTGGTGGATCT AAGTCCTCCCCGGGTGTCACTGAAGTACCCGATAATTTGCAGCAGTATCACTTGGGTAAC TTAAGAGTAACATGTATTAGGACTCCATGCCATACAAAAGATTCCATATGCTATTATATC AAAGATTTAGAAACAGGTGAGCAGTGCATCTTCACAGGCGACACTTTATTCATTGCCGGT TGTGGGAGGTTTTTCGAGGGCACAGGAAGAGATATGGACATGGCCTTAAACCAGATAATG TTAAGGGCTGTTGGTGAGACGAACTGGAATAAGGTTAAAATATACCCTGGTCATGAGTAC ACCAAAGGCAATGTTAGCTTTATCAGAGCAAAAATCTATTCCGATATAGGGCAGAACAAG GAGTTTGATGCGTTGGAACAGTATTGCAAATCTAACGAGTGCACCACCGGTCACTTCACC CTGAGAGATGAACTAGGTTATAACCCATTCATGAGATTGGATGATCGTGCCGTTAGACTA GCAGTCGGCGATACTGCTGGGACTTATCCCAGATCCGTAGTGATGCAAGAGTTAAGAAAG CTTAAAAACGCTATGTAA
Protein Properties
Pfam Domain Function
Protein Residues285
Protein Molecular Weight32338.59961
Protein Theoretical pI7.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Hydroxyacylglutathione hydrolase, mitochondrial MKFLLQQIRNMHVKPIKMRWLTGGVNYSYLLSTEDRRNSWLIDPAEPLEVSPKLSAEEKK SIDAIVNTHHHYDHSGGNLALYSILCQENSGHDIKIIGGSKSSPGVTEVPDNLQQYHLGN LRVTCIRTPCHTKDSICYYIKDLETGEQCIFTGDTLFIAGCGRFFEGTGRDMDMALNQIM LRAVGETNWNKVKIYPGHEYTKGNVSFIRAKIYSDIGQNKEFDALEQYCKSNECTTGHFT LRDELGYNPFMRLDDRAVRLAVGDTAGTYPRSVVMQELRKLKNAM
References
External Links
ResourceLink
Saccharomyces Genome Database GLO4
Uniprot IDQ12320
Uniprot NameGLO4_YEAST
GenBank Gene IDAY692965
Genebank Protein ID51013381
General Reference
  • Bito, A., Haider, M., Hadler, I., Breitenbach, M. (1997). "Identification and phenotypic analysis of two glyoxalase II encoding genes from Saccharomyces cerevisiae, GLO2 and GLO4, and intracellular localization of the corresponding proteins." J Biol Chem 272:21509-21519.9261170
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287