You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNADPH-dependent methylglyoxal reductase GRE2
Synonyms
  • Genes de respuesta a estres protein 2
Gene NameGRE2
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCatalyzes the irreversible reduction of the cytotoxic compound methylglyoxal (MG) to (R)-lactaldehyde as an alternative to detoxification of MG by glyoxalase I GLO1. MG is synthesized via a bypath of glycolysis from dihydroxyacetone phosphate and is believed to play a role in cell cycle regulation and stress adaptation
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
Stress-activated signalling pathways: high osmolarity test 1PW002773 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Lactaldehyde + NADPPyruvaldehyde + NADP + hydron
KEGG Reactions
Pyruvaldehyde + NADPH + hydronNADP + Lactaldehyde
Metabolites
YMDB IDNameView
YMDB00022AcetaldehydeShow
YMDB00167LactaldehydeShow
YMDB00170PyruvaldehydeShow
YMDB00283GlycerolShow
YMDB00286D-GlucoseShow
YMDB00383Gluconic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB004993-methylbutanalShow
YMDB00570isoamylolShow
YMDB00575D-glyceraldehydeShow
YMDB00798IsopentanolShow
YMDB00862hydronShow
YMDB00883EthanolShow
YMDB00975gluconateShow
GO Classification
Component
Not Available
Function
binding
cofactor binding
coenzyme binding
catalytic activity
Process
cellular metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 15
LocusYOL151W
Gene Sequence>1029 bp ATGTCAGTTTTCGTTTCAGGTGCTAACGGGTTCATTGCCCAACACATTGTCGATCTCCTG TTGAAGGAAGACTATAAGGTCATCGGTTCTGCCAGAAGTCAAGAAAAGGCCGAGAATTTA ACGGAGGCCTTTGGTAACAACCCAAAATTCTCCATGGAAGTTGTCCCAGACATATCTAAG CTGGACGCATTTGACCATGTTTTCCAAAAGCACGGCAAGGATATCAAGATAGTTCTACAT ACGGCCTCTCCATTCTGCTTTGATATCACTGACAGTGAACGCGATTTATTAATTCCTGCT GTGAACGGTGTTAAGGGAATTCTCCACTCAATTAAAAAATACGCCGCTGATTCTGTAGAA CGTGTAGTTCTCACCTCTTCTTATGCAGCTGTGTTCGATATGGCAAAAGAAAACGATAAG TCTTTAACATTTAACGAAGAATCCTGGAACCCAGCTACCTGGGAGAGTTGCCAAAGTGAC CCAGTTAACGCCTACTGTGGTTCTAAGAAGTTTGCTGAAAAAGCAGCTTGGGAATTTCTA GAGGAGAATAGAGACTCTGTAAAATTCGAATTAACTGCCGTTAACCCAGTTTACGTTTTT GGTCCGCAAATGTTTGACAAAGATGTGAAAAAACACTTGAACACATCTTGCGAACTCGTC AACAGCTTGATGCATTTATCACCAGAGGACAAGATACCGGAACTATTTGGTGGATACATT GATGTTCGTGATGTTGCAAAGGCTCATTTAGTTGCCTTCCAAAAGAGGGAAACAATTGGT CAAAGACTAATCGTATCGGAGGCCAGATTTACTATGCAGGATGTTCTCGATATCCTTAAC GAAGACTTCCCTGTTCTAAAAGGCAATATTCCAGTGGGGAAACCAGGTTCTGGTGCTACC CATAACACCCTTGGTGCTACTCTTGATAATAAAAAGAGTAAGAAATTGTTAGGTTTCAAG TTCAGGAACTTGAAAGAGACCATTGACGACACTGCCTCCCAAATTTTAAAATTTGAGGGC AGAATATAA
Protein Properties
Pfam Domain Function
Protein Residues342
Protein Molecular Weight38169.19922
Protein Theoretical pI6.06
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>NADPH-dependent methylglyoxal reductase GRE2 MSVFVSGANGFIAQHIVDLLLKEDYKVIGSARSQEKAENLTEAFGNNPKFSMEVVPDISK LDAFDHVFQKHGKDIKIVLHTASPFCFDITDSERDLLIPAVNGVKGILHSIKKYAADSVE RVVLTSSYAAVFDMAKENDKSLTFNEESWNPATWESCQSDPVNAYCGSKKFAEKAAWEFL EENRDSVKFELTAVNPVYVFGPQMFDKDVKKHLNTSCELVNSLMHLSPEDKIPELFGGYI DVRDVAKAHLVAFQKRETIGQRLIVSEARFTMQDVLDILNEDFPVLKGNIPVGKPGSGAT HNTLGATLDNKKSKKLLGFKFRNLKETIDDTASQILKFEGRI
References
External Links
ResourceLink
Saccharomyces Genome Database GRE2
Uniprot IDQ12068
Uniprot NameGRE2_YEAST
GenBank Gene IDAY558040
Genebank Protein ID45269970
General Reference
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Hauser, M., Horn, P., Tournu, H., Hauser, N. C., Hoheisel, J. D., Brown, A. J., Dickinson, J. R. (2007). "A transcriptome analysis of isoamyl alcohol-induced filamentation in yeast reveals a novel role for Gre2p as isovaleraldehyde reductase." FEMS Yeast Res 7:84-92.16999827
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Chen, C. N., Porubleva, L., Shearer, G., Svrakic, M., Holden, L. G., Dover, J. L., Johnston, M., Chitnis, P. R., Kohl, D. H. (2003). "Associating protein activities with their genes: rapid identification of a gene encoding a methylglyoxal reductase in the yeast Saccharomyces cerevisiae." Yeast 20:545-554.12722185
  • Garay-Arroyo, A., Covarrubias, A. A. (1999). "Three genes whose expression is induced by stress in Saccharomyces cerevisiae." Yeast 15:879-892.10407268
  • Lee, J., Godon, C., Lagniel, G., Spector, D., Garin, J., Labarre, J., Toledano, M. B. (1999). "Yap1 and Skn7 control two specialized oxidative stress response regulons in yeast." J Biol Chem 274:16040-16046.10347154
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Murata, K., Fukuda, Y., Simosaka, M., Watanabe, K., Saikusa, T., Kimura, A. (1985). "Metabolism of 2-oxoaldehyde in yeasts. Purification and characterization of NADPH-dependent methylglyoxal-reducing enzyme from Saccharomyces cerevisiae." Eur J Biochem 151:631-636.3896793
  • Rep, M., Proft, M., Remize, F., Tamas, M., Serrano, R., Thevelein, J. M., Hohmann, S. (2001). "The Saccharomyces cerevisiae Sko1p transcription factor mediates HOG pathway-dependent osmotic regulation of a set of genes encoding enzymes implicated in protection from oxidative damage." Mol Microbiol 40:1067-1083.11401713
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • van Iersel, M. F., Eppink, M. H., van Berkel, W. J., Rombouts, F. M., Abee, T. (1997). "Purification and characterization of a novel NADP-dependent branched-chain alcohol dehydrogenase from Saccharomyces cerevisiae." Appl Environ Microbiol 63:4079-4082.9327572
  • Casamayor, A., Aldea, M., Casas, C., Herrero, E., Gamo, F. J., Lafuente, M. J., Gancedo, C., Arino, J. (1995). "DNA sequence analysis of a 13 kbp fragment of the left arm of yeast chromosome XV containing seven new open reading frames." Yeast 11:1281-1288.8553699