You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHomocysteine S-methyltransferase 2
Synonyms
  • S-adenosylmethionine metabolism protein 4
  • S-methylmethionine:homocysteine methyltransferase 2
  • SMM:Hcy S-methyltransferase 2
Gene NameSAM4
Enzyme Class
Biological Properties
General FunctionInvolved in homocysteine S-methyltransferase activity
Specific FunctionHomocysteine S-methyltransferase involved in the conversion of S-adenosylmethionine (AdoMet) to methionine to control the methionine/AdoMet ratio. Converts also S- methylmethionine (SMM) to methionine
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Cysteine and methionine metabolismec00270 Map00270
SMPDB ReactionsNot Available
KEGG Reactions
L-Homocysteine + S-AdenosylmethionineL-Methionine + S-Adenosylhomocysteine + hydron
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00318L-MethionineShow
YMDB00347S-Methyl-L-methionineShow
YMDB00371HomocysteineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00520L-HomocysteineShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
homocysteine S-methyltransferase activity
catalytic activity
transferase activity
transferase activity, transferring one-carbon groups
methyltransferase activity
S-methyltransferase activity
Process
Not Available
Gene Properties
Chromosome Locationchromosome 16
LocusYPL273W
Gene Sequence>978 bp ATGGCACGTCTTCCTCTAAAGCAGTTCTTAGCGGATAACCCCAAAAAAGTTCTTGTTCTT GACGGTGGTCAAGGAACAGAACTGGAAAACAGAGGTATCAAAGTTGCAAATCCCGTGTGG TCTACTATTCCATTTATTAGCGAATCATTTTGGTCTGATGAGTCATCTGCTAACAGAAAA ATTGTCAAAGAAATGTTCAACGATTTCTTGAATGCTGGCGCAGAAATATTGATGACTACA ACATACCAAACGAGTTATAAATCAGTTTCTGAAAACACCCCAATCAGAACTTTATCCGAG TACAATAACCTTTTAAACAGGATTGTCGATTTTTCTCGTAATTGTATTGGCGAAGACAAA TATTTGATTGGCTGTATTGGCCCATGGGGTGCTCATATTTGTCGTGAGTTTACAGGCGAC TATGGTGCTGAGCCAGAAAATATTGATTTCTACCAATACTTCAAGCCTCAGTTGGAGAAT TTCAATAAAAATGACAAATTGGATTTGATTGGGTTTGAAACCATTCCTAACATCCATGAA CTGAAAGCTATCTTATCTTGGGATGAGAGTATCCTGTCTAGACCCTTCTATATCGGGTTG TCTGTGCATGAGCACGGTGTCTTGAGAGACGGCACTACCATGGAAGAAATCGCACAAGTT ATTAAGGACTTGGGCGACAAAATAAATCCTAACTTCTCGTTCTTAGGAATCAACTGCGTC AGCTTCAACCAATCACCCGACATTCTTGAGTCTCTACATCAAGCACTACCAAATATGGCC TTGCTTGCTTATCCAAACAGTGGTGAAGTTTATGATACTGAAAAGAAGATATGGTTGCCA AATAGCGATAAGCTGAACAGTTGGGATACGGTTGTTAAACAGTACATTAGCAGCGGTGCC CGTATCATTGGTGGTTGTTGCAGAACAAGTCCAAAAGACATCCAAGAGATTTCTGCAGCC GTCAAGAAATACACGTAA
Protein Properties
Pfam Domain Function
Protein Residues325
Protein Molecular Weight36668.19922
Protein Theoretical pI4.88
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Homocysteine S-methyltransferase 2 MARLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDESSANRK IVKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDK YLIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHE LKAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCV SFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGA RIIGGCCRTSPKDIQEISAAVKKYT
References
External Links
ResourceLink
Saccharomyces Genome Database SAM4
Uniprot IDQ08985
Uniprot NameSAM4_YEAST
GenBank Gene IDZ73629
Genebank Protein ID1370563
General Reference
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Thomas, D., Becker, A., Surdin-Kerjan, Y. (2000). "Reverse methionine biosynthesis from S-adenosylmethionine in eukaryotic cells." J Biol Chem 275:40718-40724.11013242
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956