You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePutative thiosulfate sulfurtransferase
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in thiosulfate sulfurtransferase activity
Specific FunctionThiosulfate + cyanide = sulfite + thiocyanate
Cellular LocationMitochondrion. Cytoplasm
SMPDB Pathways
Sulfur metabolismPW002483 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Sulfur metabolismec00920 Map00920
SMPDB Reactions
Cyanide + ThiosulfateThiocyanate + Sulfite + hydron
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00074CyanideShow
YMDB00114SulfiteShow
YMDB00303ThiosulfateShow
YMDB00391ThiocyanateShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
transferase activity, transferring sulfur-containing groups
sulfurtransferase activity
thiosulfate sulfurtransferase activity
catalytic activity
transferase activity
Process
anion transport
inorganic anion transport
sulfate transport
establishment of localization
transport
ion transport
Gene Properties
Chromosome LocationNot Available
LocusYOR251C
Gene Sequence>915 bp ATGCCATTATTTGATCTTATTTCTCCAAAAGCGTTTGTTAAGTTAGTGGCCAGTGAGAAG GTTCATAGAATCGTTCCAGTTGATGCAACATGGTACCTACCCAGTTGGAAGCTTGATAAT AAAGTGGATTTCTTGACCAAACCACGTATACCAAACTCCATTTTCTTTGATATTGATGCA ATCAGTGACAAAAAATCGCCCTATCCACATATGTTCCCTACAAAGAAGGTTTTTGACGAC GCTATGAGTAATTTAGGAGTTCAAAAAGATGATATATTAGTGGTTTACGATCGTGTTGGT AACTTTAGCTCCCCTAGATGTGCTTGGACATTAGGAGTGATGGGACATCCTAAGGTGTAC TTACTAAATAATTTCAACCAGTACAGAGAGTTTAAGTACCCTCTAGATTCCTCTAAGGTG GCAGCGTTTTCACCCTATCCAAAGAGTCATTATGAGTCCTCAGAAAGTTTCCAAGACAAG GAGATTGTAGACTATGAGGAAATGTTCCAATTGGTAAAGAGTGGGGAACTGGCTAAGAAA TTCAATGCTTTCGATGCAAGGTCGCTCGGTAGATTCGAAGGTACAGAACCAGAGCCTCGT TCCGACATTCCATCGGGGCATATTCCAGGTACCCAACCATTACCATATGGAAGTTTACTT GATCCGGAGACCAAAACGTACCCAGAAGCTGGGGAGGCGATACACGCTACTTTGGAAAAG GCATTGAAAGACTTTCATTGCACTTTGGACCCAAGTAAACCAACTATTTGCTCTTGTGGA ACTGGCGTTTCAGGAGTCATTATCAAGACAGCATTGGAGCTAGCAGGAGTTCCCAATGTT AGATTATATGATGGATCCTGGACCGAGTGGGTCTTGAAATCCGGGCCCGAGTGGATTGCT GAAAACAGAGATTAA
Protein Properties
Pfam Domain Function
Protein Residues304
Protein Molecular Weight34218.60156
Protein Theoretical pI5.93
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Putative thiosulfate sulfurtransferase MPLFDLISPKAFVKLVASEKVHRIVPVDATWYLPSWKLDNKVDFLTKPRIPNSIFFDIDA ISDKKSPYPHMFPTKKVFDDAMSNLGVQKDDILVVYDRVGNFSSPRCAWTLGVMGHPKVY LLNNFNQYREFKYPLDSSKVAAFSPYPKSHYESSESFQDKEIVDYEEMFQLVKSGELAKK FNAFDARSLGRFEGTEPEPRSDIPSGHIPGTQPLPYGSLLDPETKTYPEAGEAIHATLEK ALKDFHCTLDPSKPTICSCGTGVSGVIIKTALELAGVPNVRLYDGSWTEWVLKSGPEWIA ENRD
References
External Links
ResourceLink
Saccharomyces Genome Database YOR251C
Uniprot IDQ08686
Uniprot NameTHTR_YEAST
GenBank Gene IDAY692732
Genebank Protein ID51012915
General Reference
  • Poirey, R., Jauniaux, J. C. (1997). "Sequencing analysis of a 36.8 kb fragment of yeast chromosome XV reveals 26 open reading frames including SEC63, CDC31, SUG2, GCD1, RBL2, PNT1, PAC1 and VPH1." Yeast 13:483-487.9153759
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956