You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNicotinamide-nucleotide adenylyltransferase 1
Synonyms
  • NAD(+) diphosphorylase 1
  • NAD(+) pyrophosphorylase 1
  • NMN adenylyltransferase 1
Gene NameNMA1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotidyltransferase activity
Specific FunctionATP + nicotinamide ribonucleotide = diphosphate + NAD(+)
Cellular LocationNot Available
SMPDB Pathways
NAD metabolismPW002421 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Nicotinate and nicotinamide metabolismec00760 Map00760
SMPDB Reactions
Nicotinic acid mononucleotide + hydron + Adenosine triphosphatedeamido-NAD(+) + Pyrophosphate
Nicotinamide ribotide + Adenosine triphosphate + hydronPyrophosphate + NAD
KEGG Reactions
Adenosine triphosphate + hydron + Nicotinamide ribotidePyrophosphate + NAD
Adenosine triphosphate + hydron + Nicotinic acid mononucleotidePyrophosphate + deamido-NAD(+)
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00110NADShow
YMDB00138Nicotinamide ribotideShow
YMDB00193Nicotinic acid mononucleotideShow
YMDB00219PyrophosphateShow
YMDB00306deamido-NAD(+)Show
YMDB00412NAD(+)Show
YMDB00741nicotinic acid D-ribonucleotideShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
Process
NAD biosynthetic process
metabolic process
biosynthetic process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
coenzyme biosynthetic process
pyridine nucleotide biosynthetic process
nicotinamide nucleotide biosynthetic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR328W
Gene Sequence>1206 bp ATGGATCCCACAAGAGCTCCGGATTTCAAACCGCCATCTGCAGACGAGGAATTGATTCCT CCACCCGACCCGGAATCTAAAATTCCCAAATCTATTCCAATTATTCCATACGTCTTAGCC GATGCGAATTCCTCTATAGATGCACCTTTTAATATTAAGAGGAAGAAAAAGCATCCTAAG CATCATCATCACCATCATCACAGTCGTAAAGAAGGCAATGATAAAAAACATCAGCATATT CCATTGAACCAAGACGACTTTCAACCACTTTCCGCAGAAGTGTCTTCCGAAGATGATGAC GCGGATTTTAGATCCAAGGAGAGATACGGTTCAGATTCAACCACAGAATCAGAAACTAGA GGTGTTCAGAAATATCAGATTGCTGATTTAGAAGAAGTTCCACATGGAATCGTTCGTCAA GCAAGAACCTTGGAAGACTACGAATTCCCCTCACACAGATTATCGAAAAAATTACTGGAT CCAAATAAACTGCCGTTAGTAATAGTAGCATGTGGGTCTTTTTCACCAATCACCTACTTG CATCTAAGAATGTTTGAAATGGCTTTAGATGCAATCTCTGAACAAACAAGGTTTGAAGTC ATAGGTGGATATTACTCCCCTGTTAGTGATAACTATCAAAAGCAAGGCTTGGCCCCATCC TACCATAGAGTACGTATGTGTGAATTGGCCTGCGAAAGAACCTCATCTTGGTTGATGGTG GATGCATGGGAGTCATTGCAACCTTCATACACAAGAACTGCCAAGGTCTTGGATCATTTC AATCACGAAATCAATATTAAGAGAGGTGGTGTAGCTACTGTTACTGGAGAAAAAATTGGT GTGAAAATAATGTTGCTGGCTGGTGGTGACCTAATAGAGTCAATGGGTGAACCAAACGTT TGGGCGGACGCCGATTTACATCACATTCTCGGTAATTACGGTTGTTTGATTGTCGAACGT ACTGGTTCTGATGTAAGGTCTTTTTTGTTATCCCATGATATTATGTATGAACATAGAAGG AATATTCTTATCATCAAGCAACTCATCTATAATGATATTTCTTCCACGAAAGTTCGTCTA TTTATCAGACGCGCCATGTCTGTACAATATTTGTTACCTAATTCGGTCATCAGGTATATC CAAGAACATAGACTATATGTGGACCAAACCGAACCTGTTAAGCAAGTTCTTGGAAACAAA GAATGA
Protein Properties
Pfam Domain Function
Protein Residues401
Protein Molecular Weight45858.60156
Protein Theoretical pI6.89
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Nicotinamide-nucleotide adenylyltransferase 1 MDPTRAPDFKPPSADEELIPPPDPESKIPKSIPIIPYVLADANSSIDAPFNIKRKKKHPK HHHHHHHSRKEGNDKKHQHIPLNQDDFQPLSAEVSSEDDDADFRSKERYGSDSTTESETR GVQKYQIADLEEVPHGIVRQARTLEDYEFPSHRLSKKLLDPNKLPLVIVACGSFSPITYL HLRMFEMALDAISEQTRFEVIGGYYSPVSDNYQKQGLAPSYHRVRMCELACERTSSWLMV DAWESLQPSYTRTAKVLDHFNHEINIKRGGVATVTGEKIGVKIMLLAGGDLIESMGEPNV WADADLHHILGNYGCLIVERTGSDVRSFLLSHDIMYEHRRNILIIKQLIYNDISSTKVRL FIRRAMSVQYLLPNSVIRYIQEHRLYVDQTEPVKQVLGNKE
References
External Links
ResourceLink
Saccharomyces Genome Database NMA1
Uniprot IDQ06178
Uniprot NameNMA1_YEAST
GenBank Gene IDU20618
Genebank Protein ID662140
General Reference
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Emanuelli, M., Carnevali, F., Lorenzi, M., Raffaelli, N., Amici, A., Ruggieri, S., Magni, G. (1999). "Identification and characterization of YLR328W, the Saccharomyces cerevisiae structural gene encoding NMN adenylyltransferase. Expression and characterization of the recombinant enzyme." FEBS Lett 455:13-17.10428462
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956