You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameArginyl-tRNA synthetase, cytoplasmic
Synonyms
  • Arginine--tRNA ligase
  • ArgRS
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionForms part of a macromolecular complex that catalyzes the attachment of specific amino acids to cognate tRNAs during protein synthesis
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
L-Arginine + Adenosine triphosphate + tRNA(Arg) → Adenosine monophosphate + Pyrophosphate + Arg-tRNA(Arg)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00592L-ArginineShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
aminoacyl-tRNA ligase activity
catalytic activity
nucleotide binding
ligase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
arginine-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
Process
metabolic process
cellular macromolecule metabolic process
macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
biosynthetic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
arginyl-tRNA aminoacylation
Gene Properties
Chromosome LocationNot Available
LocusYDR341C
Gene Sequence>1824 bp ATGGCTAGCACAGCAAATATGATTTCTCAACTAAAGAAACTATCTATCGCGGAACCTGCG GTTGCCAAGGATTCTCATCCTGATGTAAATATCGTGGATTTGATGAGAAATTACATTTCA CAAGAATTAAGCAAGATTTCCGGCGTAGACTCGTCTCTTATTTTTCCAGCATTAGAATGG ACAAATACTATGGAGAGAGGCGATTTGTTGATTCCTATCCCAAGATTGAGAATCAAAGGT GCCAATCCAAAGGATTTGGCAGTCCAATGGGCTGAAAAATTTCCATGTGGAGATTTCTTG GAGAAAGTTGAAGCGAATGGCCCGTTCATCCAGTTTTTCTTCAACCCTCAATTTTTAGCA AAACTTGTCATCCCAGATATCTTAACCAGAAAGGAGGATTATGGTTCTTGCAAATTGGTT GAAAACAAGAAAGTTATTATTGAATTCTCCTCTCCCAACATTGCCAAGCCATTTCATGCT GGTCATTTAAGATCCACTATTATTGGTGGCTTTTTGGCCAACCTTTATGAAAAATTAGGT TGGGAGGTTATCAGAATGAACTACCTGGGTGACTGGGGTAAACAATTTGGTCTTTTAGCT GTTGGTTTTGAAAGATACGGTAATGAAGAGGCTTTAGTTAAGGATCCAATTCACCACCTG TTCGATGTTTACGTTCGTATCAACAAGGATATTGAGGAAGAAGGTGACAGTATTCCATTA GAACAATCCACCAATGGAAAAGCTCGTGAATATTTCAAGAGAATGGAAGATGGTGACGAG GAAGCTTTAAAAATTTGGAAGAGATTCCGTGAATTTTCTATTGAAAAATATATTGACACA TATGCACGTTTGAACATCAAATATGATGTTTACTCTGGTGAATCTCAAGTTTCTAAAGAA TCCATGCTCAAAGCTATCGACCTGTTCAAGGAAAAGGGCTTAACACATGAGGATAAGGGT GCAGTTTTGATCGATTTGACAAAATTTAACAAAAAGTTAGGAAAGGCTATTGTTCAAAAA TCGGACGGTACTACGTTATATCTAACTAGAGACGTTGGTGCAGCTATGGACCGTTATGAA AAGTATCATTTTGACAAGATGATTTACGTTATCGCTTCTCAACAAGATTTGCACGCTGCC CAATTCTTCGAAATTTTGAAGCAGATGGGCTTTGAGTGGGCTAAAGATCTACAGCATGTC AACTTTGGTATGGTCCAAGGTATGTCAACAAGAAAAGGTACTGTTGTCTTCTTAGATAAT ATCTTGGAGGAAACTAAGGAAAAAATGCACGAAGTTATGAAAAAGAATGAGAACAAATAC GCGCAAATTGAGCATCCAGAAGAAGTTGCCGATTTAGTTGGTATCTCTGCCGTCATGATT CAAGATATGCAAGGTAAGCGTATCAACAACTACGAGTTTAAATGGGAAAGAATGCTTTCA TTCGAAGGTGACACTGGTCCATACCTTCAATATGCTCACTCAAGGTTAAGATCAGTTGAA AGAAATGCTTCTGGTATCACCCAAGAAAAATGGATAAATGCCGATTTTTCGTTATTAAAA GAACCTGCCGCAAAACTGTTGATTAGACTGCTAGGCCAATACCCCGATGTTTTGAGAAAT GCAATCAAAACCCACGAGCCAACAACCGTGGTCACATATTTATTCAAATTGACTCACCAG GTTTCTTCTTGTTATGACGTCTTATGGGTTGCTGGTCAAACTGAAGAATTAGCAACTGCC CGTCTGGCTCTATATGGTGCTGCAAGACAAGTTTTATACAACGGTATGCGCTTGTTAGGT TTAACTCCCGTAGAAAGAATGTAA
Protein Properties
Pfam Domain Function
Protein Residues607
Protein Molecular Weight69524.39844
Protein Theoretical pI6.76
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Arginyl-tRNA synthetase, cytoplasmic MASTANMISQLKKLSIAEPAVAKDSHPDVNIVDLMRNYISQELSKISGVDSSLIFPALEW TNTMERGDLLIPIPRLRIKGANPKDLAVQWAEKFPCGDFLEKVEANGPFIQFFFNPQFLA KLVIPDILTRKEDYGSCKLVENKKVIIEFSSPNIAKPFHAGHLRSTIIGGFLANLYEKLG WEVIRMNYLGDWGKQFGLLAVGFERYGNEEALVKDPIHHLFDVYVRINKDIEEEGDSIPL EQSTNGKAREYFKRMEDGDEEALKIWKRFREFSIEKYIDTYARLNIKYDVYSGESQVSKE SMLKAIDLFKEKGLTHEDKGAVLIDLTKFNKKLGKAIVQKSDGTTLYLTRDVGAAMDRYE KYHFDKMIYVIASQQDLHAAQFFEILKQMGFEWAKDLQHVNFGMVQGMSTRKGTVVFLDN ILEETKEKMHEVMKKNENKYAQIEHPEEVADLVGISAVMIQDMQGKRINNYEFKWERMLS FEGDTGPYLQYAHSRLRSVERNASGITQEKWINADFSLLKEPAAKLLIRLLGQYPDVLRN AIKTHEPTTVVTYLFKLTHQVSSCYDVLWVAGQTEELATARLALYGAARQVLYNGMRLLG LTPVERM
References
External Links
ResourceLink
Saccharomyces Genome Database YDR341C
Uniprot IDQ05506
Uniprot NameSYRC_YEAST
GenBank Gene IDU51032
Genebank Protein ID1230668
PDB ID
1F7V
General Reference
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Cavarelli, J., Delagoutte, B., Eriani, G., Gangloff, J., Moras, D. (1998). "L-arginine recognition by yeast arginyl-tRNA synthetase." EMBO J 17:5438-5448.9736621