You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameUncharacterized protein YMR130W
SynonymsNot Available
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionNot Available
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00073Glycerol 3-phosphateShow
YMDB00283GlycerolShow
YMDB00807glycolic acidShow
YMDB00858Phosphoglycolic acidShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00989glycerol 1-phosphateShow
YMDB00994glycerol 2-phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
phosphatase activity
phosphoglycolate phosphatase activity
Process
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYMR130W
Gene Sequence>909 bp ATGACCTATCCGAAAAGAATACCTATAAATGCGTGGTCTGAAGTTCATAGGGTGGCAAGG CCACTAATTATTACTTTCGACGCATATAATACACTATACGCCACAAAACTTCCCGTCATG GAACAATACTGCATTGTTGGGCGTAAATATGGTATCAAGGCGAATCCTTCGACTTTAACA AACAATTTTCCACACGTTTTTAAAAAACTGAAGGAAGACTATCCCCAATACGGAAAATAT TCTGGTATCAAGCCCGAACAATGGTGGTCCATCTTGATTAGGAACGTCTTCGCACCAAAC GAAATTCCCGATGAGATGATAAATGAAATATTAATGCGGTTTGAGGGCTTCGATTCGTAT TTTGTTTATCCAGATTTGATCAAATTTTTAAAGGATTTGAAGTCAAGACATCCTGATGTT ATCTTAGGAATAGTAAGCAATACTGATCCAATTTTTTACAAATTATTAAAGAATATCGGA TTATTTGAGACATTTTCCGGTCACATTTATTTATCATATGAGCTTAATCTCGCCAAACCT GATAGAGCAATATTTCAATATGCGCTTGACGATATTATATCTAAACAACCTCATTTACTC GAAAAGTACACCAGGGAGGAAATTCTACAGCATTGCTTTCACATCGGAGATGAATTAAAG AACGATCTCGAAGGGGCAGAAGCTGCCGGTTGGACTGGTATACTGTTAGATAGAAATGAT AAATACGGGTTTCTTTCAAACTCGATTAGTAAACCAATGCGGGACGAATACAAGCTGTCA ATTGATAAAATAGATAATAATTCAATAAACACTTGGGAAGCCAATACTAAGCAAACTGAC ACGTTACAGTTGAGTGAAAGAAAGTACGTTGTTTCGAATCTTGAGGTTTTAGAGGAACTC TTTCCCTGA
Protein Properties
Pfam Domain Function
Protein Residues302
Protein Molecular Weight35278.10156
Protein Theoretical pI6.18
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Uncharacterized protein YMR130W MTYPKRIPINAWSEVHRVARPLIITFDAYNTLYATKLPVMEQYCIVGRKYGIKANPSTLT NNFPHVFKKLKEDYPQYGKYSGIKPEQWWSILIRNVFAPNEIPDEMINEILMRFEGFDSY FVYPDLIKFLKDLKSRHPDVILGIVSNTDPIFYKLLKNIGLFETFSGHIYLSYELNLAKP DRAIFQYALDDIISKQPHLLEKYTREEILQHCFHIGDELKNDLEGAEAAGWTGILLDRND KYGFLSNSISKPMRDEYKLSIDKIDNNSINTWEANTKQTDTLQLSERKYVVSNLEVLEEL FP
References
External Links
ResourceLink
Saccharomyces Genome Database YMR130W
Uniprot IDQ04223
Uniprot NameYM14_YEAST
GenBank Gene IDAY557987
Genebank Protein ID45269864
General Reference
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872