You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoglucomutase YMR278W
Synonyms
  • PGM
  • Glucose phosphomutase
Gene NameNot Available
Enzyme Class
Biological Properties
General FunctionInvolved in intramolecular transferase activity, phosphotransferases
Specific FunctionThis enzyme participates in both the breakdown and synthesis of glucose
Cellular LocationCytoplasm. Nucleus
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Galactose metabolismec00052 Map00052
Glycolysis / Gluconeogenesisec00010 Map00010
Pentose phosphate pathwayec00030 Map00030
Purine metabolismec00230 Map00230
SMPDB Reactions
Glucose 1-phosphate + Glyceric acid 1,3-biphosphateAlpha-D-Glucose 1,6-bisphosphate + 3-Phosphoglyceric acid
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00270Glyceric acid 1,3-biphosphateShow
YMDB00288Glucose 1-phosphateShow
YMDB003413-Phosphoglyceric acidShow
YMDB00947Glucose 6-phosphateShow
YMDB16160Alpha-D-Glucose 1,6-bisphosphateShow
GO Classification
Component
Not Available
Function
intramolecular transferase activity
intramolecular transferase activity, phosphotransferases
catalytic activity
binding
ion binding
cation binding
metal ion binding
magnesium ion binding
isomerase activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYMR278W
Gene Sequence>1869 bp ATGTTGCAAGGAATTTTAGAAACCGTACCATCTGACTTGAAAGATCCGATATCATTATGG TTTAAGCAAGACCGCAACCCAAAAACTATAGAAGAGGTCACCGCTCTCTGCAAAAAATCC GACTGGAATGAGTTACACAAAAGATTTGATTCTAGAATTCAGTTTGGCACTGCTGGTTTA AGATCGCAAATGCAAGCTGGCTTTAGCAGGATGAATACTTTAGTAGTCATACAAGCGTCT CAGGGATTGGCAACTTATGTAAGACAACAGTTTCCAGACAATTTGGTAGCTGTTGTGGGA CACGATCATAGATTCCATTCTAAGGAGTTCGCTAGAGCTACTGCTGCTGCATTTCTTTTA AAAGGATTTAAGGTACATTATTTGAATCCTGACCACGAATTTGTTCATACCCCTTTAGTT CCCTTTGCAGTGGATAAGCTAAAGGCCTCCGTTGGCGTAATGATAACAGCAAGTCACAAC CCAAAAATGGATAATGGATATAAAGTATACTATTCCAATGGATGCCAAATCATTCCACCT CACGATCATGCCATCTCTGATTCCATTGACGCAAATTTAGAACCATGGGCCAATGTGTGG GATTTCGACGATGTTCTAAATAAGGCTCTCAAACAAGGGAAATTGATGTATTCCAGAGAA GAAATGCTGAAGTTATATTTAGAGGAGGTTTCTAAAAATCTGGTAGAAATCAACCCATTA AAGCTTGAAGTAAAAGCCAAACCTTGGTTCGTTTACACTCCAATGCATGGGGTTGGATTT GACATTTTCAGCACCATCGTAAAAAAAACACTGTGCCTGGTAGAAGGTAAGGATTACCTA TGTGTTCCTGAACAACAAAATCCAGATCCTTCTTTCCCAACTGTTGGATTTCCTAACCCT GAAGAAAAAGGTGCTTTAGACATTGGTATAAACTTGGCTGAAAAACATGACATTGACTTA CTTGTTGCCAACGACCCTGACGCTGATAGATTCTCTGTTGCTGTTAAAGATATGCAGTCA GGCGAATGGCGACAACTAACAGGTAACGAAATCGGTTTTCTTTTTGCATTTTATGAATAT CAGAAATATAAAAGTATGGACAAAGAATTTCAGCACGTTCATCCGTTGGCTATGTTAAAT TCAACAGTGTCTTCACAAATGATAAAAAAAATGGCAGAAATAGAAGGGTTCCATTATGAG GATACATTAACAGGATTTAAGTGGATCGGAAATCGTGCCATACTCTTGGAAAAGAAAGGC TATTACGTTCCTTTTGGATTCGAGGAAGCAATAGGCTACATGTTTCCAGCAATGGAGCAT GATAAGGATGGTATCAGTGCATCCATTGTCTTCTTGCAAGCCTACTGTAAGTGGAAAATA GACCACAATTTGGACCCGCTAAATGTCTTAGAAAATGGCTTCAAAAAATATGGCGTGTTC AAAGAGTACAATGGCTATTATGTCGTTCCAAATCCAACTGTTACAAAAGATATATTTGAC TACATCAGGAATGTCTACACTCCTGAGGGCGCGTCATATCCTTCATCTATTGGTGAAGAA ATCGAAGTACTTTACTATCGAGATTTAACCACTGGTTACCAATCGGATACCATAAATCAT AAACCTACTCTACCCGTCGATCCTACATCACAAATGATAACAGTATCTGCTAGACCAAGT AACGGTAGTGAGAATGAGCATATCCGCTTCACTATTCGCGGGTCCGGAACAGAACCAAAA CTTAAAGTATATATTGAAGCTTGCGCAAATGAAGAACAAAGAGCCTCTTTCTTGGCGAAA TTGACTTGGAATGTGCTGAGACGTGAATGGTTTAGACCAGATGAAATGAATATAGTTACA AAATTTTGA
Protein Properties
Pfam Domain Function
Protein Residues622
Protein Molecular Weight71068.60156
Protein Theoretical pI6.21
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoglucomutase YMR278W MLQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGL RSQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLL KGFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPP HDHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPL KLEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH KPTLPVDPTSQMITVSARPSNGSENEHIRFTIRGSGTEPKLKVYIEACANEEQRASFLAK LTWNVLRREWFRPDEMNIVTKF
References
External Links
ResourceLink
Saccharomyces Genome Database YMR278W
Uniprot IDQ03262
Uniprot NamePGM3_YEAST
GenBank Gene IDZ49704
Genebank Protein ID825544
General Reference
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Tiwari, A., Bhat, J. P. (2008). "Molecular characterization reveals that YMR278w encoded protein is environmental stress response homologue of Saccharomyces cerevisiae PGM2." Biochem Biophys Res Commun 366:340-345.18042468
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956