You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProtein ARG5,6, mitochondrial
Synonyms
  • N-acetyl-gamma-glutamyl-phosphate reductase
  • N-acetyl-glutamate semialdehyde dehydrogenase
  • NAGSA dehydrogenase
  • Acetylglutamate kinase
  • N-acetyl-L-glutamate 5-phosphotransferase
  • NAG kinase
  • AGK
Gene NameARG5
Enzyme Class
Biological Properties
General FunctionInvolved in acetylglutamate kinase activity
Specific FunctionN-acetyl-L-glutamate 5-semialdehyde + NADP(+) + phosphate = N-acetyl-5-glutamyl phosphate + NADPH
Cellular LocationMitochondrion
SMPDB PathwaysNot Available
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + N-acetyl-L-glutamic acidN-Acetyl-L-glutamyl 5-phosphate + ADP
N-Acetyl-L-glutamyl 5-phosphate + NADPH + hydronNADP + phosphate + 2-Acetamido-5-oxopentanoic acid
Metabolites
YMDB IDNameView
YMDB00047N-Acetyl-L-glutamyl 5-phosphateShow
YMDB00066N-acetyl-L-glutamic acidShow
YMDB00109Adenosine triphosphateShow
YMDB00255N-Acetyl-L-glutamate 5-semialdehydeShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB005362-Acetamido-5-oxopentanoic acidShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
organelle
intracellular part
membrane-bounded organelle
cytoplasm
intracellular membrane-bounded organelle
mitochondrion
cell part
Function
NAD or NADH binding
binding
catalytic activity
transferase activity
nucleotide binding
oxidoreductase activity
protein dimerization activity
transferase activity, transferring phosphorus-containing groups
kinase activity
oxidoreductase activity, acting on the aldehyde or oxo group of donors
oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor
protein binding
N-acetyl-gamma-glutamyl-phosphate reductase activity
acetylglutamate kinase activity
Process
glutamine family amino acid metabolic process
metabolic process
arginine biosynthetic process
oxidation reduction
cellular metabolic process
arginine metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
cellular amino acid biosynthetic process
Gene Properties
Chromosome LocationNot Available
LocusYER069W
Gene Sequence>2592 bp ATGCCATCTGCTAGCTTACTCGTCTCGACAAAGAGACTTAACGCTTCCAAATTCCAAAAA TTTGTGTCTTCATTAAACAAATCCACCATAGCAGGATTTGCATCTGTACCCTTGAGAGCT CCACCATCCGTTGCATTTACGAGAAAGAAAGTCGGATACTCAAAGAGGTATGTTTCATCT ACTAACGGCTTTTCAGCTACTAGATCCACTGTGATCCAACTGTTGAACAATATCAGCACA AAAAGAGAGGTTGAACAATATTTGAAATATTTCACTTCCGTCTCACAACAACAATTTGCT GTGATCAAGGTGGGTGGTGCCATTATCAGCGACAATCTACACGAACTCGCTTCCTGCTTG GCATTTTTGTATCATGTTGGTCTATATCCAATAGTTTTACATGGTACCGGTCCTCAGGTT AATGGAAGGCTAGAAGCGCAGGGAATTGAGCCAGACTATATTGATGGTATTAGAATCACG GATGAGCACACAATGGCCGTAGTTAGAAAATGTTTTTTGGAACAAAATCTTAAGCTAGTT ACTGCATTAGAACAGCTAGGGGTCCGTGCAAGACCCATTACTTCTGGTGTTTTTACTGCT GACTATTTGGATAAGGACAAATACAAGCTAGTGGGCAATATTAAAAGTGTCACAAAAGAG CCAATTGAAGCATCTATTAAGGCAGGTGCCCTACCAATCTTGACCTCTTTAGCCGAAACT GCTTCTGGTCAAATGTTGAACGTCAACGCCGACGTAGCTGCTGGTGAATTAGCCCGTGTT TTTGAGCCTTTGAAGATCGTTTACCTGAATGAGAAAGGGGGTATTATCAATGGCTCCACG GGAGAAAAAATTTCGATGATCAATTTGGATGAAGAGTATGACGATTTAATGAAGCAAAGT TGGGTGAAGTATGGTACCAAATTAAAAATTAGAGAAATTAAAGAGCTTTTGGACTATCTT CCTCGTTCTTCTTCAGTTGCAATCATTAACGTTCAAGATCTACAAAAAGAACTGTTCACT GATTCTGGTGCGGGTACTATGATCAGGAGAGGTTACAAATTAGTGAAGAGATCCTCCATT GGCGAATTTCCATCCGCTGATGCTCTAAGAAAAGCTCTTCAAAGGGACGCTGGCATTAGT TCCGGTAAAGAATCTGTTGCTTCTTATTTAAGATATTTGGAAAACTCTGATTTTGTCTCT TATGCTGATGAACCTCTTGAAGCAGTGGCCATTGTAAAGAAAGATACGAACGTTCCCACA CTAGACAAATTTGTCTGTTCTGACGCAGCCTGGTTGAATAACGTCACAGATAATGTATTC AATGTTTTGCGCCGTGATTTTCCTGCTTTACAATGGGTAGTCAGTGAAAATGATGCTAAC ATTGCATGGCATTTTGATAAGTCTCAAGGTTCATATCTAAAAGGCGGAAAAGTTTTGTTC TGGTATGGTATCGATGATATAAATACAATATCCGAGCTCGTTGAAAATTTTGTGAAGTCG TGTGACACTGCTTCTACCCTCAACTCATCAGCAAGTAGTGGAGTATTTGCTAACAAAAAA TCAGCTAGGTCGTACTCAACTAGATCCACTCCTCGTCCCGAGGGAGTTAACACCAACCCT GGTCGTGTCGCGCTTATTGGTGCTAGAGGTTACACAGGTAAAAATTTGGTATCTTTGATC AACGGCCACCCATATTTAGAAGTGGCCCATGTTTCTTCTCGTGAATTGAAAGGTCAAAAG TTGCAAGATTATACAAAATCCGAAATTATATATGAAAGTTTGCAAATACAGGATATTAGG AAACTGGAAGAACAAAATGCTGTGGACTTTTGGGTTATGGCATTACCCAACAAAGTCTGT GAACCTTTCGTTGAGACAATCCAAAGTGTTCATGGTAAGTCTAAAATTATTGATCTGTCC GCTGATCACAGGTTTGTATCAGAATCAGACTGGGCTTACGGTTTGCCAGAATTGAATGAT AGAGCAAAAATTGCAAACGCTGCCAAAATTGCTAATCCCGGTTGTTATGCTACTGGTTCG CAATTAACTATTTCTCCGTTAACAAAGTATATCAATGGTCTTCCAACTGTGTTTGGTGTT TCAGGGTATTCAGGCGCGGGGACGAAGCCTTCTCCAAAAAACGATCCCAAATTCTTGAAC AATAACTTAATTCCTTACGCTTTAAGTGATCATATACACGAACGCGAAATCTCAGCTCGC ATTGGGCACAATGTTGCATTCATGCCCCATGTTGGGCAGTGGTTTCAAGGTATCTCTTTG ACCGTCTCTATTCCAATAAAAAAAGGTTCCTTGTCTATTGATGAGATCAGGAAATTATAC AGAAATTTTTACGAAGACGAAAAGCTAGTACATGTCATCGATGATATCCCACTGGTTAAA GATATTGAGGGCACCCATGGTGTAGTTATTGGTGGTTTCAAGCTGAATGATGCTGAAGAT CGTGTAGTTGTTTGCGCAACCATCGATAACTTACTTAAAGGCGCCGCTACTCAATGTCTG CAAAATATTAATCTTGCTATGGGTTATGGAGAGTATGCTGGTATCCCTGAAAATAAAATT ATTGGTGTCTGA
Protein Properties
Pfam Domain Function
Protein Residues863
Protein Molecular Weight94868.39844
Protein Theoretical pI8.45
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Protein ARG5,6, mitochondrial MPSASLLVSTKRLNASKFQKFVSSLNKSTIAGFASVPLRAPPSVAFTRKKVGYSKRYVSS TNGFSATRSTVIQLLNNISTKREVEQYLKYFTSVSQQQFAVIKVGGAIISDNLHELASCL AFLYHVGLYPIVLHGTGPQVNGRLEAQGIEPDYIDGIRITDEHTMAVVRKCFLEQNLKLV TALEQLGVRARPITSGVFTADYLDKDKYKLVGNIKSVTKEPIEASIKAGALPILTSLAET ASGQMLNVNADVAAGELARVFEPLKIVYLNEKGGIINGSTGEKISMINLDEEYDDLMKQS WVKYGTKLKIREIKELLDYLPRSSSVAIINVQDLQKELFTDSGAGTMIRRGYKLVKRSSI GEFPSADALRKALQRDAGISSGKESVASYLRYLENSDFVSYADEPLEAVAIVKKDTNVPT LDKFVCSDAAWLNNVTDNVFNVLRRDFPALQWVVSENDANIAWHFDKSQGSYLKGGKVLF WYGIDDINTISELVENFVKSCDTASTLNSSASSGVFANKKSARSYSTRSTPRPEGVNTNP GRVALIGARGYTGKNLVSLINGHPYLEVAHVSSRELKGQKLQDYTKSEIIYESLQIQDIR KLEEQNAVDFWVMALPNKVCEPFVETIQSVHGKSKIIDLSADHRFVSESDWAYGLPELND RAKIANAAKIANPGCYATGSQLTISPLTKYINGLPTVFGVSGYSGAGTKPSPKNDPKFLN NNLIPYALSDHIHEREISARIGHNVAFMPHVGQWFQGISLTVSIPIKKGSLSIDEIRKLY RNFYEDEKLVHVIDDIPLVKDIEGTHGVVIGGFKLNDAEDRVVVCATIDNLLKGAATQCL QNINLAMGYGEYAGIPENKIIGV
References
External Links
ResourceLink
Saccharomyces Genome Database ARG5
Uniprot IDQ01217
Uniprot NameARG56_YEAST
GenBank Gene IDU18813
Genebank Protein ID603305
General Reference
  • Boonchird, C., Messenguy, F., Dubois, E. (1991). "Characterization of the yeast ARG5,6 gene: determination of the nucleotide sequence, analysis of the control region and of ARG5,6 transcript." Mol Gen Genet 226:154-166.1851947
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Boonchird, C., Messenguy, F., Dubois, E. (1991). "Determination of amino acid sequences involved in the processing of the ARG5/ARG6 precursor in Saccharomyces cerevisiae." Eur J Biochem 199:325-335.1649049
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956