You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit
Synonyms
  • General glucose sensor subunit 1
  • Glycogen metabolism control protein GLC6
  • Trehalose synthase complex catalytic subunit TPS1
  • Trehalose-6-phosphate synthase
  • UDP-glucose-glucosephosphate glucosyltransferase
Gene NameTPS1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionSynthase catalytic subunit of the trehalose synthase complex that catalyzes the production of trehalose from glucose-6- phosphate and UDP-glucose in a two step process. Can function independently of the complex
Cellular LocationCytoplasm
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Uridine diphosphate glucose + alpha-D-glucose 6 phosphateUridine 5'-diphosphate + Trehalose 6-phosphate
Trehalose 6-phosphate + waterTrehalose + phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00008TrehaloseShow
YMDB00137Trehalose 6-phosphateShow
YMDB00212Uridine diphosphate glucoseShow
YMDB00228alpha,alpha-trehalose 6-phosphateShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00947Glucose 6-phosphateShow
YMDB16263alpha-D-glucose 6 phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
UDP-glycosyltransferase activity
transferase activity
UDP-glucosyltransferase activity
transferase activity, transferring glycosyl groups
alpha,alpha-trehalose-phosphate synthase (UDP-forming) activity
Process
oligosaccharide metabolic process
disaccharide metabolic process
trehalose metabolic process
trehalose biosynthetic process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR126C
Gene Sequence>1488 bp ATGACTACGGATAACGCTAAGGCGCAACTGACCTCGTCTTCAGGGGGTAACATTATTGTG GTGTCCAACAGGCTTCCCGTGACAATCACTAAAAACAGCAGTACGGGACAGTACGAGTAC GCAATGTCGTCCGGAGGGCTGGTCACGGCGTTGGAAGGGTTGAAGAAGACGTACACTTTC AAGTGGTTCGGATGGCCTGGGCTAGAGATTCCTGACGATGAGAAGGATCAGGTGAGGAAG GACTTGCTGGAAAAGTTTAATGCCGTACCCATCTTCCTGAGCGATGAAATCGCAGACTTA CACTACAACGGGTTCAGTAATTCTATTCTATGGCCGTTATTCCATTACCATCCTGGTGAG ATCAATTTCGACGAGAATGCGTGGTTGGCATACAACGAGGCAAACCAGACGTTCACCAAC GAGATTGCTAAGACTATGAACCATAACGATTTAATCTGGGTGCATGATTACCATTTGATG TTGGTTCCGGAAATGTTGAGAGTCAAGATTCACGAGAAGCAACTGCAAAACGTTAAGGTC GGGTGGTTCCTGCACACACCATTCCCTTCGAGTGAAATTTACAGAATCTTACCTGTCAGA CAAGAGATTTTGAAGGGTGTTTTGAGTTGTGATTTAGTCGGGTTCCACACATACGATTAT GCAAGACATTTCTTGTCTTCCGTGCAAAGAGTGCTTAACGTGAACACATTGCCTAATGGG GTGGAATACCAGGGCAGATTCGTTAACGTAGGGGCCTTCCCTATCGGTATCGACGTGGAC AAGTTCACCGATGGGTTGAAAAAGGAATCCGTACAAAAGAGAATCCAACAATTGAAGGAA ACTTTCAAGGGCTGCAAGATCATAGTTGGTGTCGACAGGCTGGATTACATCAAAGGTGTG CCTCAGAAGTTGCACGCCATGGAAGTGTTTCTGAACGAGCATCCAGAATGGAGGGGCAAG GTTGTTCTGGTACAGGTTGCAGTGCCAAGTCGTGGAGATGTGGAAGAGTACCAATATTTA AGATCTGTGGTCAATGAGTTGGTCGGTAGAATCAACGGTCAGTTCGGTACTGTGGAATTC GTCCCCATCCATTTCATGCACAAGTCTATACCATTTGAAGAGCTGATTTCGTTATATGCT GTGAGCGATGTTTGTTTGGTCTCGTCCACCCGTGATGGTATGAACTTGGTTTCCTACGAA TATATTGCTTGCCAAGAAGAAAAGAAAGGTTCCTTAATCCTGAGTGAGTTCACAGGTGCC GCACAATCCTTGAATGGTGCTATTATTGTAAATCCTTGGAACACCGATGATCTTTCTGAT GCCATCAACGAGGCCTTGACTTTGCCCGATGTAAAGAAAGAAGTTAACTGGGAAAAACTT TACAAATACATCTCTAAATACACTTCTGCCTTCTGGGGTGAAAATTTCGTCCATGAATTA TACAGTACATCATCAAGCTCAACAAGCTCCTCTGCCACCAAAAACTGA
Protein Properties
Pfam Domain Function
Protein Residues495
Protein Molecular Weight56147.5
Protein Theoretical pI6.0
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 56 kDa subunit MTTDNAKAQLTSSSGGNIIVVSNRLPVTITKNSSTGQYEYAMSSGGLVTALEGLKKTYTF KWFGWPGLEIPDDEKDQVRKDLLEKFNAVPIFLSDEIADLHYNGFSNSILWPLFHYHPGE INFDENAWLAYNEANQTFTNEIAKTMNHNDLIWVHDYHLMLVPEMLRVKIHEKQLQNVKV GWFLHTPFPSSEIYRILPVRQEILKGVLSCDLVGFHTYDYARHFLSSVQRVLNVNTLPNG VEYQGRFVNVGAFPIGIDVDKFTDGLKKESVQKRIQQLKETFKGCKIIVGVDRLDYIKGV PQKLHAMEVFLNEHPEWRGKVVLVQVAVPSRGDVEEYQYLRSVVNELVGRINGQFGTVEF VPIHFMHKSIPFEELISLYAVSDVCLVSSTRDGMNLVSYEYIACQEEKKGSLILSEFTGA AQSLNGAIIVNPWNTDDLSDAINEALTLPDVKKEVNWEKLYKYISKYTSAFWGENFVHEL YSTSSSSTSSSATKN
References
External Links
ResourceLink
Saccharomyces Genome Database TPS1
Uniprot IDQ00764
Uniprot NameTPS1_YEAST
GenBank Gene IDAF061037
Genebank Protein ID3150451
General Reference
  • Nelson, H., Mandiyan, S., Nelson, N. (1989). "A conserved gene encoding the 57-kDa subunit of the yeast vacuolar H+-ATPase." J Biol Chem 264:1775-1778.2521486
  • Bell, W., Klaassen, P., Ohnacker, M., Boller, T., Herweijer, M., Schoppink, P., Van der Zee, P., Wiemken, A. (1992). "Characterization of the 56-kDa subunit of yeast trehalose-6-phosphate synthase and cloning of its gene reveal its identity with the product of CIF1, a regulator of carbon catabolite inactivation." Eur J Biochem 209:951-959.1425702
  • McDougall, J., Kaasen, I., Strom, A. R. (1993). "A yeast gene for trehalose-6-phosphate synthase and its complementation of an Escherichia coli otsA mutant." FEMS Microbiol Lett 107:25-30.8467996
  • Gonzalez, M. I., Stucka, R., Blazquez, M. A., Feldmann, H., Gancedo, C. (1992). "Molecular cloning of CIF1, a yeast gene necessary for growth on glucose." Yeast 8:183-192.1315471
  • Van Aelst, L., Hohmann, S., Bulaya, B., de Koning, W., Sierkstra, L., Neves, M. J., Luyten, K., Alijo, R., Ramos, J., Coccetti, P. (1993). "Molecular cloning of a gene involved in glucose sensing in the yeast Saccharomyces cerevisiae." Mol Microbiol 8:927-943.8355617
  • Cannon, J. F., Pringle, J. R., Fiechter, A., Khalil, M. (1994). "Characterization of glycogen-deficient glc mutants of Saccharomyces cerevisiae." Genetics 136:485-503.8150278
  • Vuorio, O. E., Kalkkinen, N., Londesborough, J. (1993). "Cloning of two related genes encoding the 56-kDa and 123-kDa subunits of trehalose synthase from the yeast Saccharomyces cerevisiae." Eur J Biochem 216:849-861.8404905
  • Dong, Z. Y., Duan, Y. K., Chen, H. M., Jin, C., Zhang, S. Z. (2000). "[cDNA cloning, sequence analysis of trehalose-6-phosphate synthase gene from Saccharomyces cerevisiae AS2.1416]." Sheng Wu Gong Cheng Xue Bao 16:408-410.11059292
  • Becam, A. M., Cullin, C., Grzybowska, E., Lacroute, F., Nasr, F., Ozier-Kalogeropoulos, O., Palucha, A., Slonimski, P. P., Zagulski, M., Herbert, C. J. (1994). "The sequence of 29.7 kb from the right arm of chromosome II reveals 13 complete open reading frames, of which ten correspond to new genes." Yeast 10 Suppl A:S1-11.8091856
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Mannhaupt, G., Stucka, R., Ehnle, S., Vetter, I., Feldmann, H. (1994). "Analysis of a 70 kb region on the right arm of yeast chromosome II." Yeast 10:1363-1381.7900426
  • Vandercammen, A., Francois, J., Hers, H. G. (1989). "Characterization of trehalose-6-phosphate synthase and trehalose-6-phosphate phosphatase of Saccharomyces cerevisiae." Eur J Biochem 182:613-620.2546763
  • Londesborough, J., Vuorio, O. E. (1993). "Purification of trehalose synthase from baker's yeast. Its temperature-dependent activation by fructose 6-phosphate and inhibition by phosphate." Eur J Biochem 216:841-848.8404904
  • Reinders, A., Burckert, N., Hohmann, S., Thevelein, J. M., Boller, T., Wiemken, A., De Virgilio, C. (1997). "Structural analysis of the subunits of the trehalose-6-phosphate synthase/phosphatase complex in Saccharomyces cerevisiae and their function during heat shock." Mol Microbiol 24:687-695.9194697
  • Bell, W., Sun, W., Hohmann, S., Wera, S., Reinders, A., De Virgilio, C., Wiemken, A., Thevelein, J. M. (1998). "Composition and functional analysis of the Saccharomyces cerevisiae trehalose synthase complex." J Biol Chem 273:33311-33319.9837904
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956