You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycerol-3-phosphate dehydrogenase [NAD+] 1
SynonymsNot Available
Gene NameGPD1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCatalyzes the production and accumulation of glycerol during hyperosmotic stress conditions. Glycerol acts as a osmoregulator that prevents loss of water and turgor of the cells
Cellular LocationCytoplasm. Peroxisome
SMPDB Pathways
Choline metabolismPW002494 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
Stress-activated signalling pathways: high osmolarity test 1PW002773 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
Glycerone phosphate + NADH + hydronNAD + Glycerol 3-phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00073Glycerol 3-phosphateShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00322Dihydroxyacetone phosphateShow
YMDB00862hydronShow
YMDB16273Glycerone phosphateShow
GO Classification
Component
intracellular part
cytoplasm
glycerol-3-phosphate dehydrogenase complex
macromolecular complex
protein complex
cell part
Function
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
nucleotide binding
protein binding
oxidoreductase activity
NAD or NADH binding
coenzyme binding
catalytic activity
cofactor binding
identical protein binding
binding
oxidoreductase activity, acting on CH-OH group of donors
protein homodimerization activity
glycerol-3-phosphate dehydrogenase [NAD+] activity
Process
alditol metabolic process
glycerol-3-phosphate catabolic process
glycerol metabolic process
glycerol-3-phosphate metabolic process
oxidation reduction
small molecule metabolic process
metabolic process
alcohol metabolic process
primary metabolic process
polyol metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDL022W
Gene Sequence>1176 bp ATGTCTGCTGCTGCTGATAGATTAAACTTAACTTCCGGCCACTTGGATGCTGGTAGAAAG AGAAGTTCCTCTTCTGTTTCTTTGAAGGCTGCCGAAAAGCCTTTCAAGGTTACTGTGATT GGATCTGGTAACTGGGGTACTACTATTGCCAAGGTGGTTGCCGAAAATTGTAAGGGATAC CCAGAAGTTTTCGCTCCAATAGTACAAATGTGGGTGTTCGAAGAAGAGATCAATGGTGAA AAATTGACTGAAATCATAAATACTAGACATCAAAACGTGAAATACTTGCCTGGCATCACT CTACCCGACAATTTGGTTGCTAATCCAGACTTGATTGATTCAGTCAAGGATGTCGACATC ATCGTTTTCAACATCCCACATCAATTTTTGCCCCGTATCTGTAGCCAATTGAAAGGTCAT GTTGATGCACACGTCAGAGCTATCTCCTGTCTAAAGGGTTTTGAAGTTGGTGCTAAAGGT GTCCAATTGCCATCCTCTTACATCACTGAGGAACTAGGTATTCAATGTGGTGCTCTATCT GGTGCTAGCATTGCCACCGAAGTCGCTCAAGAACACTGGTCTGAAACAACAGTTGCTTAC CACATTCCAAAGGATTTCAGAGGCGAGGGCAAGGACGTCGACCATAAGGTTCTAAAGGCC TTGTTCCACAGATCTTACTTCCACGTTAGTGTCATCGAAGATGTTGCTGGTATCTCCATC TGTGGTGCTTTGAAGAATGTTGTTGCCTTAGGTTGTGGTTTCGTCGTAGGTCTAGGCTGG GGTAACAACGCTTCTGCTGCCATCCAAAGAGTCGGTTTGGGTGAGATCATCAGATTCGGT CAAATGTTTTTCCCAGAATCTAGAGAAGAAACATACTACCAAGAGTCTGCTGGTGTTGCT GATTTGATCACCACCTGCGCTGGTGGTAGAAACGTCAAGGTTGCTAGGCTAATGGCTACT TCTGGTAAGGACGCCTGGGAATGTGAAAAGGAGTTGTTGAATGGCCAATCCGCTCAAGGT TTAATTACCTGCAAAGAAGTTCACGAATGGTTGGAAACATGTGGCTCTGTCGAAGACTTC CCATTATTTGAAGCCGTATACCAAATCGTTTACAACAACTACCCAATGAAGAACCTGCCG GACATGATTGAAGAATTAGATCTACATGAAGATTAG
Protein Properties
Pfam Domain Function
Protein Residues391
Protein Molecular Weight42868.5
Protein Theoretical pI5.16
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycerol-3-phosphate dehydrogenase [NAD+] 1 MSAAADRLNLTSGHLNAGRKRSSSSVSLKAAEKPFKVTVIGSGNWGTTIAKVVAENCKGY PEVFAPIVQMWVFEEEINGEKLTEIINTRHQNVKYLPGITLPDNLVANPDLIDSVKDVDI IVFNIPHQFLPRICSQLKGHVDSHVRAISCLKGFEVGAKGVQLLSSYITEELGIQCGALS GANIATEVAQEHWSETTVAYHIPKDFRGEGKDVDHKVLKALFHRPYFHVSVIEDVAGISI CGALKNVVALGCGFVEGLGWGNNASAAIQRVGLGEIIRFGQMFFPESREETYYQESAGVA DLITTCAGGRNVKVARLMATSGKDAWECEKELLNGQSAQGLITCKEVHEWLETCGSVEDF PLFEAVYQIVYNNYPMKNLPDMIEELDLHED
References
External Links
ResourceLink
Saccharomyces Genome Database GPD1
Uniprot IDQ00055
Uniprot NameGPD1_YEAST
GenBank Gene IDAY598965
Genebank Protein ID47420051
General Reference
  • Larsson, K., Ansell, R., Eriksson, P., Adler, L. (1993). "A gene encoding sn-glycerol 3-phosphate dehydrogenase (NAD+) complements an osmosensitive mutant of Saccharomyces cerevisiae." Mol Microbiol 10:1101-1111.7934860
  • Albertyn, J., Hohmann, S., Thevelein, J. M., Prior, B. A. (1994). "GPD1, which encodes glycerol-3-phosphate dehydrogenase, is essential for growth under osmotic stress in Saccharomyces cerevisiae, and its expression is regulated by the high-osmolarity glycerol response pathway." Mol Cell Biol 14:4135-4144.8196651
  • Wang, H. T., Rahaim, P., Robbins, P., Yocum, R. R. (1994). "Cloning, sequence, and disruption of the Saccharomyces diastaticus DAR1 gene encoding a glycerol-3-phosphate dehydrogenase." J Bacteriol 176:7091-7095.7961476
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Sleep, D., Ogden, J. E., Roberts, N. A., Goodey, A. R. (1991). "Cloning and characterisation of the Saccharomyces cerevisiae glycerol-3-phosphate dehydrogenase (GUT2) promoter." Gene 101:89-96.1676389
  • Norbeck, J., Blomberg, A. (1996). "Protein expression during exponential growth in 0.7 M NaCl medium of Saccharomyces cerevisiae." FEMS Microbiol Lett 137:1-8.8935650
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Valadi, A., Granath, K., Gustafsson, L., Adler, L. (2004). "Distinct intracellular localization of Gpd1p and Gpd2p, the two yeast isoforms of NAD+-dependent glycerol-3-phosphate dehydrogenase, explains their different contributions to redox-driven glycerol production." J Biol Chem 279:39677-39685.15210723
  • Aguilera, J., Rodriguez-Vargas, S., Prieto, J. A. (2005). "The HOG MAP kinase pathway is required for the induction of methylglyoxal-responsive genes and determines methylglyoxal resistance in Saccharomyces cerevisiae." Mol Microbiol 56:228-239.15773992
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956