You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycerol-3-phosphate dehydrogenase [NAD+] 1
SynonymsNot Available
Gene NameGPD1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionCatalyzes the production and accumulation of glycerol during hyperosmotic stress conditions. Glycerol acts as a osmoregulator that prevents loss of water and turgor of the cells
Cellular LocationCytoplasm. Peroxisome
SMPDB Pathways
Choline metabolismPW002494 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
Stress-activated signalling pathways: high osmolarity test 1PW002773 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
Glycerone phosphate + NADH + hydronNAD + Glycerol 3-phosphate
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00073Glycerol 3-phosphateShow
YMDB00110NADShow
YMDB00143NADHShow
YMDB00322Dihydroxyacetone phosphateShow
YMDB00862hydronShow
YMDB16273Glycerone phosphateShow
GO Classification
Component
glycerol-3-phosphate dehydrogenase complex
cell part
intracellular part
macromolecular complex
cytoplasm
protein complex
Function
cofactor binding
oxidoreductase activity, acting on CH-OH group of donors
catalytic activity
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
binding
protein binding
NAD or NADH binding
coenzyme binding
nucleotide binding
identical protein binding
oxidoreductase activity
protein homodimerization activity
glycerol-3-phosphate dehydrogenase [NAD+] activity
Process
small molecule metabolic process
glycerol-3-phosphate catabolic process
alcohol metabolic process
glycerol-3-phosphate metabolic process
polyol metabolic process
alditol metabolic process
metabolic process
glycerol metabolic process
primary metabolic process
carbohydrate metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 4
LocusYDL022W
Gene Sequence>1176 bp ATGTCTGCTGCTGCTGATAGATTAAACTTAACTTCCGGCCACTTGGATGCTGGTAGAAAG AGAAGTTCCTCTTCTGTTTCTTTGAAGGCTGCCGAAAAGCCTTTCAAGGTTACTGTGATT GGATCTGGTAACTGGGGTACTACTATTGCCAAGGTGGTTGCCGAAAATTGTAAGGGATAC CCAGAAGTTTTCGCTCCAATAGTACAAATGTGGGTGTTCGAAGAAGAGATCAATGGTGAA AAATTGACTGAAATCATAAATACTAGACATCAAAACGTGAAATACTTGCCTGGCATCACT CTACCCGACAATTTGGTTGCTAATCCAGACTTGATTGATTCAGTCAAGGATGTCGACATC ATCGTTTTCAACATCCCACATCAATTTTTGCCCCGTATCTGTAGCCAATTGAAAGGTCAT GTTGATGCACACGTCAGAGCTATCTCCTGTCTAAAGGGTTTTGAAGTTGGTGCTAAAGGT GTCCAATTGCCATCCTCTTACATCACTGAGGAACTAGGTATTCAATGTGGTGCTCTATCT GGTGCTAGCATTGCCACCGAAGTCGCTCAAGAACACTGGTCTGAAACAACAGTTGCTTAC CACATTCCAAAGGATTTCAGAGGCGAGGGCAAGGACGTCGACCATAAGGTTCTAAAGGCC TTGTTCCACAGATCTTACTTCCACGTTAGTGTCATCGAAGATGTTGCTGGTATCTCCATC TGTGGTGCTTTGAAGAATGTTGTTGCCTTAGGTTGTGGTTTCGTCGTAGGTCTAGGCTGG GGTAACAACGCTTCTGCTGCCATCCAAAGAGTCGGTTTGGGTGAGATCATCAGATTCGGT CAAATGTTTTTCCCAGAATCTAGAGAAGAAACATACTACCAAGAGTCTGCTGGTGTTGCT GATTTGATCACCACCTGCGCTGGTGGTAGAAACGTCAAGGTTGCTAGGCTAATGGCTACT TCTGGTAAGGACGCCTGGGAATGTGAAAAGGAGTTGTTGAATGGCCAATCCGCTCAAGGT TTAATTACCTGCAAAGAAGTTCACGAATGGTTGGAAACATGTGGCTCTGTCGAAGACTTC CCATTATTTGAAGCCGTATACCAAATCGTTTACAACAACTACCCAATGAAGAACCTGCCG GACATGATTGAAGAATTAGATCTACATGAAGATTAG
Protein Properties
Pfam Domain Function
Protein Residues391
Protein Molecular Weight42868.5
Protein Theoretical pI5.16
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycerol-3-phosphate dehydrogenase [NAD+] 1 MSAAADRLNLTSGHLNAGRKRSSSSVSLKAAEKPFKVTVIGSGNWGTTIAKVVAENCKGY PEVFAPIVQMWVFEEEINGEKLTEIINTRHQNVKYLPGITLPDNLVANPDLIDSVKDVDI IVFNIPHQFLPRICSQLKGHVDSHVRAISCLKGFEVGAKGVQLLSSYITEELGIQCGALS GANIATEVAQEHWSETTVAYHIPKDFRGEGKDVDHKVLKALFHRPYFHVSVIEDVAGISI CGALKNVVALGCGFVEGLGWGNNASAAIQRVGLGEIIRFGQMFFPESREETYYQESAGVA DLITTCAGGRNVKVARLMATSGKDAWECEKELLNGQSAQGLITCKEVHEWLETCGSVEDF PLFEAVYQIVYNNYPMKNLPDMIEELDLHED
References
External Links
ResourceLink
Saccharomyces Genome Database GPD1
Uniprot IDQ00055
Uniprot NameGPD1_YEAST
GenBank Gene IDAY598965
Genebank Protein ID47420051
General Reference
  • Larsson, K., Ansell, R., Eriksson, P., Adler, L. (1993). "A gene encoding sn-glycerol 3-phosphate dehydrogenase (NAD+) complements an osmosensitive mutant of Saccharomyces cerevisiae." Mol Microbiol 10:1101-1111.7934860
  • Albertyn, J., Hohmann, S., Thevelein, J. M., Prior, B. A. (1994). "GPD1, which encodes glycerol-3-phosphate dehydrogenase, is essential for growth under osmotic stress in Saccharomyces cerevisiae, and its expression is regulated by the high-osmolarity glycerol response pathway." Mol Cell Biol 14:4135-4144.8196651
  • Wang, H. T., Rahaim, P., Robbins, P., Yocum, R. R. (1994). "Cloning, sequence, and disruption of the Saccharomyces diastaticus DAR1 gene encoding a glycerol-3-phosphate dehydrogenase." J Bacteriol 176:7091-7095.7961476
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Sleep, D., Ogden, J. E., Roberts, N. A., Goodey, A. R. (1991). "Cloning and characterisation of the Saccharomyces cerevisiae glycerol-3-phosphate dehydrogenase (GUT2) promoter." Gene 101:89-96.1676389
  • Norbeck, J., Blomberg, A. (1996). "Protein expression during exponential growth in 0.7 M NaCl medium of Saccharomyces cerevisiae." FEMS Microbiol Lett 137:1-8.8935650
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Valadi, A., Granath, K., Gustafsson, L., Adler, L. (2004). "Distinct intracellular localization of Gpd1p and Gpd2p, the two yeast isoforms of NAD+-dependent glycerol-3-phosphate dehydrogenase, explains their different contributions to redox-driven glycerol production." J Biol Chem 279:39677-39685.15210723
  • Aguilera, J., Rodriguez-Vargas, S., Prieto, J. A. (2005). "The HOG MAP kinase pathway is required for the induction of methylglyoxal-responsive genes and determines methylglyoxal resistance in Saccharomyces cerevisiae." Mol Microbiol 56:228-239.15773992
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956