You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameIsocitrate dehydrogenase [NADP]
Synonyms
  • IDH
  • IDP
  • NADP(+)-specific ICDH
  • Oxalosuccinate decarboxylase
Gene NameIDP3
Enzyme Class
Biological Properties
General FunctionInvolved in magnesium ion binding
Specific FunctionMay function in the production of NADPH for fatty acid and sterol synthesis
Cellular LocationNot Available
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
Nitrogen metabolismPW002504 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Glutathione metabolismec00480 Map00480
Nitrogen metabolismec00910 Map00910
SMPDB Reactions
Isocitric acid + NADPCarbon dioxide + hydron + NADPH + Oxoglutaric acid
KEGG Reactions
NADP + Isocitric acidOxoglutaric acid + Carbon dioxide + NADPH
Metabolites
YMDB IDNameView
YMDB00026Isocitric acidShow
YMDB00153Oxoglutaric acidShow
YMDB00210Oxalosuccinic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
catalytic activity
isocitrate dehydrogenase activity
NAD or NADH binding
isocitrate dehydrogenase (NADP+) activity
binding
nucleotide binding
ion binding
cation binding
metal ion binding
oxidoreductase activity
magnesium ion binding
oxidoreductase activity, acting on CH-OH group of donors
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
Process
carboxylic acid metabolic process
metabolic process
cellular metabolic process
isocitrate metabolic process
oxidation reduction
organic acid metabolic process
oxoacid metabolic process
Gene Properties
Chromosome Locationchromosome 14
LocusYNL009W
Gene Sequence>1263 bp ATGAGTAAAATTAAAGTTGTTCATCCCATCGTGGAAATGGACGGTGATGAGCAGACAAGA GTTATTTGGAAACTTATCAAAGAAAAATTGATATTGCCATATTTAGATGTGGATTTAAAA TACTATGACCTTTCAATCCAAGAGCGTGATAGGACTAATGATCAAGTAACAAAGGATTCT TCTTATGCTACCCTAAAATATGGGGTTGCTGTCAAATGTGCCACTATAACACCCGATGAG GCAAGAATGAAAGAATTTAACCTTAAAGAAATGTGGAAATCTCCAAATGGAACAATCAGA AACATCCTAGGTGGAACTGTATTTAGAGAACCCATCATTATTCCAAAAATACCTCGTCTA GTCCCTCACTGGGAGAAACCTATAATTATAGGCCGTCATGCTTTTGGTGACCAATATAGG GCTACTGACATCAAGATTAAAAAAGCAGGCAAACTAAGGTTACAGTTTAGCTCAGATGAC GGTAAAGAAAACATCGATTTAAAGGTTTATGAATTTCCTAAAAGTGGTGGGATCGCAATG GCAATGTTTAATACAAATGATTCCATTAAAGGGTTCGCAAAGGCATCCTTCGAATTAGCT CTCAAAAGAAAACTACCGTTATTCTTTACAACCAAAAACACTATTCTGAAAAATTATGAT AATCAGTTCAAACAAATTTTCGATAATTTGTTCGATAAAGAATATAAGGAAAAGTTTCAG GCTTTAAAAATAACGTACGAGCATCGTTTGATTGATGATATGGTAGCACAGATGCTAAAA TCAAAGGGCGGGTTTATAATCGCCATGAAGAATTATGATGGCGATGTCCAGTCTGACATT GTGGCACAAGGATTTGGGTCTCTTGGTTTAATGACGTCCATATTGATTACACCTGATGGT AAAACGTTTGAAAGCGAGGCTGCCCATGGTACGGTGACCAGACATTTTAGAAAACATCAA AGAGGCGAAGAAACATCAACAAATTCAATAGCCTCAATATTTGCCTGGACAAGGGCAATT ATACAAAGAGGAAAATTAGACAATACAGATGATGTTATAAAATTTGGAAACTTACTAGAA AAGGCTACTTTGGACACAGTTCAAGTGGGCGGAAAAATGACCAAGGATTTAGCATTGATG CTTGGAAAGACTAATAGATCATCATATGTAACCACAGAAGAGTTTATTGATGAAGTTGCC AAGAGGCTTCAAAACATGATGCTCAGCTCCAATGAAGACAAGAAAGGTATGTGCAAACTA TAA
Protein Properties
Pfam Domain Function
Protein Residues420
Protein Molecular Weight47856.0
Protein Theoretical pI9.79
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Isocitrate dehydrogenase [NADP] MSKIKVVHPIVEMDGDEQTRVIWKLIKEKLILPYLDVDLKYYDLSIQERDRTNDQVTKDS SYATLKYGVAVKCATITPDEARMKEFNLKEMWKSPNGTIRNILGGTVFREPIIIPKIPRL VPHWEKPIIIGRHAFGDQYRATDIKIKKAGKLRLQFSSDDGKENIDLKVYEFPKSGGIAM AMFNTNDSIKGFAKASFELALKRKLPLFFTTKNTILKNYDNQFKQIFDNLFDKEYKEKFQ ALKITYEHRLIDDMVAQMLKSKGGFIIAMKNYDGDVQSDIVAQGFGSLGLMTSILITPDG KTFESEAAHGTVTRHFRKHQRGEETSTNSIASIFAWTRAIIQRGKLDNTDDVIKFGNLLE KATLDTVQVGGKMTKDLALMLGKTNRSSYVTTEEFIDEVAKRLQNMMLSSNEDKKGMCKL
References
External Links
ResourceLink
Saccharomyces Genome Database IDP3
Uniprot IDP53982
Uniprot NameIDHH_YEAST
GenBank Gene IDAY693154
Genebank Protein ID51013759
General Reference
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287