You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHexose transporter HXT17
SynonymsNot Available
Gene NameHXT17
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transmembrane transporter activity
Specific FunctionProbable glucose transporter
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00862hydronShow
YMDB00894D-MannoseShow
GO Classification
Component
membrane
membrane part
intrinsic to membrane
integral to membrane
cell part
Function
transporter activity
transmembrane transporter activity
substrate-specific transmembrane transporter activity
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 14
LocusYNR072W
Gene Sequence>1695 bp ATGCAATCATCCACTGAAAGTGATAGAGATATTCAGGATGGTCCTGATGCTGATATTCAC GTCGCACCACCCGTGGAAAAAGAGTGGTCAGATGGATTTGATGACAACGAAGTCATAAAC GGGGATAACGTTGAGCCACCAAAAAGAGGGCTCATAGGTTATCTTGTCATTTACTTATTG TGTTATCCAATATCCTTCGGGGGTTTCCTGCCTGGTTGGGATAGTGGTATCACAGCAGGT TTCATTAACATGGACAACTTTAAAATGAACTTCGGTTCTTACAAGCATAGCACTGGTGAA TATTATTTGAGCAACGTGCGTATGGGTCTTCTTGTGGCTATGTTCAGTATTGGATGTGCC ATAGGTGGTCTTATTTTTGCCCGTCTTGCTGATACTTTAGGTAGAAGGCTGGCAATTGTA ATCGTGGTGTTGGTATATATGGTTGGTGCAATTATTCAGATCAGTTCGAATCACAAATGG TACCAATACTTCGTTGGTAAGATTATCTATGGTCTTGGTGCTGGTGGCTGTTCGGTGTTG TGTCCAATGCTTTTGTCTGAAATAGCTCCTACAGATTTGAGAGGTGGACTTGTCTCATTG TACCAACTTAACATGACCTTCGGTATTTTCTTGGGTTATTGTAGCGTTTATGGTACGAGA AAATACGATAACACTGCACAATGGAGAGTCCCACTTGGGCTTTGCTTTTTATGGACTTTG ATTATCATCATTGGTATGTTATTGGTTCCAGAGTCCCCAAGATATCTTATTGAATGTGAG AGACACGAAGAGGCCCGTGCTTCCATTGCCAAAATCAACAAGGTTTCACCAGAGGATCCA TGGGTACTCAAACAGGCTGATGAAATCAACGCCGGTGTCCTTGCCCAAAGAGAACTAGGA GAAGCTTCATGGAAAGAACTTTTCTCCGTCAAAACTAAAGTCCTTCAACGTTTGATCACA GGTATTCTTGTGCAAACCTTTTTGCAACTTACTGGTGAAAACTACTTTTTCTTCTACGGA ACTACCATTTTCAAATCAGTCGGTCTTACTGATGGGTTTGAGACGTCGATCGTTCTAGGT ACAGTGAACTTCTTTTCCACTATTATTGCTGTTATGGTCGTAGACAAAATTGGCCGTCGT AAATGTCTTTTATTTGGTGCAGCTGGGATGATGGCTTGTATGGTCATATTTGCAAGTATC GGGGTGAAATGTCTTTACCCTCATGGCCAGGATGGTCCATCCTCAAAAGGTGCAGGTAAT GCCATGATTGTGTTCACTTGCTTCTATATATTTTGCTTTGCAACGACATGGGCTCCTGTT GCTTATATTGTGGTTGCCGAGTCGTTCCCTTCGAAGGTCAAATCTAGGGCCATGTCGATT TCGACTGCATGCAACTGGTTGTGGCAATTTTTGATCGGGTTTTTCACACCATTCATTACT GGGTCTATCCACTTCTATTATGGTTATGTGTTCGTAGGTTGTTTGGTTGCAATGTTTCTG TACGTTTTCTTCTTTTTACCAGAAACGATTGGTCTATCTTTGGAGGAAATCCAATTACTA TATGAAGAAGGTATAAAACCATGGAAATCTGCATCTTGGGTCCCACCTTCTAGGAGAGGT ATTCCTTCCGAAGAAAGTAAGACCGAGAAGAAGGATTGGAAGAAATTTTTGAAGTTCTCA AAGGGTTCTGATTGA
Protein Properties
Pfam Domain Function
Protein Residues564
Protein Molecular Weight62827.69922
Protein Theoretical pI7.01
Signalling Regions
  • None
Transmembrane Regions
  • 53-73
  • 110-130
  • 137-157
  • 168-188
  • 195-215
  • 230-250
  • 334-350
  • 357-374
  • 382-402
  • 425-445
  • 463-483
  • 485-505
Protein Sequence>Hexose transporter HXT17 MQSSTESDRDIQDGPDADIHVAPPVEKEWSDGFDDNEVINGDNVEPPKRGLIGYLVIYLL CYPISFGGFLPGWDSGITAGFINMDNFKMNFGSYKHSTGEYYLSNVRMGLLVAMFSIGCA IGGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVL CPMLLSEIAPTDLRGGLVSLYQLNMTFGIFLGYCSVYGTRKYDNTAQWRVPLGLCFLWTL IIIIGMLLVPESPRYLIECERHEEARASIAKINKVSPEDPWVLKQADEINAGVLAQRELG EASWKELFSVKTKVLQRLITGILVQTFLQLTGENYFFFYGTTIFKSVGLTDGFETSIVLG TVNFFSTIIAVMVVDKIGRRKCLLFGAAGMMACMVIFASIGVKCLYPHGQDGPSSKGAGN AMIVFTCFYIFCFATTWAPVAYIVVAESFPSKVKSRAMSISTACNWLWQFLIGFFTPFIT GSIHFYYGYVFVGCLVAMFLYVFFFLPETIGLSLEEIQLLYEEGIKPWKSASWVPPSRRG IPSEESKTEKKDWKKFLKFSKGSD
References
External Links
ResourceLink
Saccharomyces Genome Database HXT17
Uniprot IDP53631
Uniprot NameHXT17_YEAST
GenBank Gene IDZ71687
Genebank Protein ID1302608
General Reference
  • Philippsen, P., Kleine, K., Pohlmann, R., Dusterhoft, A., Hamberg, K., Hegemann, J. H., Obermaier, B., Urrestarazu, L. A., Aert, R., Albermann, K., Altmann, R., Andre, B., Baladron, V., Ballesta, J. P., Becam, A. M., Beinhauer, J., Boskovic, J., Buitrago, M. J., Bussereau, F., Coster, F., Crouzet, M., D'Angelo, M., Dal Pero, F., De Antoni, A., Del Rey, F., Doignon, F., Domdey, H., Dubois, E., Fiedler, T., Fleig, U., Floeth, M., Fritz, C., Gaillardin, C., Garcia-Cantalejo, J. M., Glansdorff, N. N., Goffeau, A., Gueldener, U., Herbert, C., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hinni, K., Iraqui Houssaini, I., Jacquet, M., Jimenez, A., Jonniaux, J. L., Karpfinger, L., Lanfranchi, G., Lepingle, A., Levesque, H., Lyck, R., Maftahi, M., Mallet, L., Maurer, K. C., Messenguy, F., Mewes, H. W., Mosti, D., Nasr, F., Nicaud, J. M., Niedenthal, R. K., Pandolfo, D., Pierard, A., Piravandi, E., Planta, R. J., Pohl, T. M., Purnelle, B., Rebischung, C., Remacha, M., Revuelta, J. L., Rinke, M., Saiz, J. E., Sartorello, F., Scherens, B., Sen-Gupta, M., Soler-Mira, A., Urbanus, J. H., Valle, G., Van Dyck, L., Verhasselt, P., Vierendeels, F., Vissers, S., Voet, M., Volckaert, G., Wach, A., Wambutt, R., Wedler, H., Zollner, A., Hani, J. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIV and its evolutionary implications." Nature 387:93-98.9169873