You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameNicotinamide-nucleotide adenylyltransferase 2
Synonyms
  • NAD(+) diphosphorylase 2
  • NAD(+) pyrophosphorylase 2
  • NMN adenylyltransferase 2
Gene NameNMA2
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotidyltransferase activity
Specific FunctionATP + nicotinamide ribonucleotide = diphosphate + NAD(+);ATP + nicotinate ribonucleotide = diphosphate + deamido-NAD+
Cellular LocationNucleus
SMPDB Pathways
NAD metabolismPW002421 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Nicotinate and nicotinamide metabolismec00760 Map00760
SMPDB Reactions
Nicotinic acid mononucleotide + hydron + Adenosine triphosphatedeamido-NAD(+) + Pyrophosphate
Nicotinamide ribotide + Adenosine triphosphate + hydronPyrophosphate + NAD
KEGG Reactions
Adenosine triphosphate + hydron + Nicotinamide ribotidePyrophosphate + NAD
Adenosine triphosphate + hydron + Nicotinic acid mononucleotidePyrophosphate + deamido-NAD(+)
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00110NADShow
YMDB00138Nicotinamide ribotideShow
YMDB00193Nicotinic acid mononucleotideShow
YMDB00219PyrophosphateShow
YMDB00306deamido-NAD(+)Show
YMDB00412NAD(+)Show
YMDB00741nicotinic acid D-ribonucleotideShow
YMDB00862hydronShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
nucleotidyltransferase activity
catalytic activity
transferase activity
Process
biosynthetic process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
coenzyme biosynthetic process
pyridine nucleotide biosynthetic process
nicotinamide nucleotide biosynthetic process
NAD biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR010W
Gene Sequence>1188 bp ATGGATCCCACCAAAGCACCCGATTTTAAACCGCCACAGCCAAATGAAGAACTACAACCA CCGCCAGATCCAACACATACGATACCAAAATCTGGACCCATAGTTCCATATGTTTTAGCT GATTATAATTCTTCGATCGATGCTCCTTTCAATCTCGACATTTACAAAACCCTGTCGTCA AGGAAAAAAAACGCCAACTCAAGCAACCGAATGGACCATATTCCATTAAATACTAGTGAC TTCCAGCCACTATCTCGGGATGTATCATCGGAGGAGGAAAGTGAAGGGCAATCGAATGGA ATTGACGCTACTCTACAGGATGTTACGATGACTGGGAATTTGGGGGTACTGAAGAGCCAA ATTGCTGATTTGGAAGAAGTTCCTCACACAATTGTAAGACAAGCCAGAACTATTGAAGAT TACGAATTTCCTGTACACAGATTGACGAAAAAGTTACAAGATCCTGAAAAACTGCCTCTG ATCATCGTTGCTTGTGGATCATTTTCTCCCATAACATACCTACATTTGAGAATGTTTGAA ATGGCTTTAGATGATATCAATGAGCAAACGCGTTTTGAAGTGGTTGGTGGTTATTTTTCT CCAGTAAGTGATAACTATCAAAAGCGAGGGTTAGCCCCAGCTTATCATCGTGTCCGCATG TGCGAATTAGCATGCGAGCGGACATCATCTTGGTTAATGGTTGATGCCTGGGAATCTTTA CAATCAAGTTATACAAGGACAGCAAAAGTCTTGGACCATTTCAATCATGAAATAAATATC AAGAGAGGTGGAATCATGACTGTAGATGGTGAAAAAATGGGCGTAAAAATCATGTTATTG GCAGGCGGTGATCTTATCGAATCCATGGGCGAGCCTCATGTGTGGGCTGATTCAGACCTG CACCATATTTTGGGTAATTATGGATGTTTGATCGTGGAAAGGACTGGTTCTGATGTTAGG TCCTTCTTGCTTTCCCATGATATCATGTATGAACACAGAAGAAATATCCTTATTATCAAA CAACTTATTTACAATGATATTTCCTCTACGAAAGTGCGGCTTTTCATCAGACGTGGAATG TCAGTTCAATATCTTCTTCCAAACTCTGTCATCCGTTACATCCAAGAGTATAATCTATAC ATTAATCAAAGTGAACCGGTCAAGCAGGTCTTGGATAGCAAAGAGTGA
Protein Properties
Pfam Domain Function
Protein Residues395
Protein Molecular Weight44908.69922
Protein Theoretical pI5.75
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Nicotinamide-nucleotide adenylyltransferase 2 MDPTKAPDFKPPQPNEELQPPPDPTHTIPKSGPIVPYVLADYNSSIDAPFNLDIYKTLSS RKKNANSSNRMDHIPLNTSDFQPLSRDVSSEEESEGQSNGIDATLQDVTMTGNLGVLKSQ IADLEEVPHTIVRQARTIEDYEFPVHRLTKKLQDPEKLPLIIVACGSFSPITYLHLRMFE MALDDINEQTRFEVVGGYFSPVSDNYQKRGLAPAYHRVRMCELACERTSSWLMVDAWESL QSSYTRTAKVLDHFNHEINIKRGGIMTVDGEKMGVKIMLLAGGDLIESMGEPHVWADSDL HHILGNYGCLIVERTGSDVRSFLLSHDIMYEHRRNILIIKQLIYNDISSTKVRLFIRRGM SVQYLLPNSVIRYIQEYNLYINQSEPVKQVLDSKE
References
External Links
ResourceLink
Saccharomyces Genome Database NMA2
Uniprot IDP53204
Uniprot NameNMA2_YEAST
GenBank Gene IDZ72795
Genebank Protein ID1322971
General Reference
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Anderson, R. M., Bitterman, K. J., Wood, J. G., Medvedik, O., Cohen, H., Lin, S. S., Manchester, J. K., Gordon, J. I., Sinclair, D. A. (2002). "Manipulation of a nuclear NAD+ salvage pathway delays aging without altering steady-state NAD+ levels." J Biol Chem 277:18881-18890.11884393
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950