You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameSterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating
SynonymsNot Available
Gene NameERG26
Enzyme Class
Biological Properties
General FunctionInvolved in 3-beta-hydroxy-delta5-steroid dehydrogenase activity
Specific Function3-beta-hydroxy-4-beta-methyl-5-alpha-cholest- 7-ene-4-alpha-carboxylate + NAD(P)(+) = 4-alpha-methyl-5-alpha- cholest-7-en-3-one + CO(2) + NAD(P)H
Cellular LocationEndoplasmic reticulum membrane; Peripheral membrane protein
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(12:0)PW002548 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(16:0)PW002550 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(18:0)PW002551 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Steroid biosynthesisec00100 Map00100
SMPDB Reactions
4β-methyl-4α-carboxy-cholesta-8,24-dien-3β-ol + NADP3-Keto-4-methylzymosterol + Carbon dioxide + NADPH
4α-carboxy-5α-cholesta-8,24-dien-3β-ol + NADPzymosterol intermediate 2 + Carbon dioxide + NADPH
KEGG Reactions
NADP + zymosterol intermediate 1czymosterol intermediate 2 + Carbon dioxide + NADPH + hydron
NAD + 4beta-methylzymosterol-4alpha-carboxylic acidNADH + 3-dehydro-4-methylzymosterol + Carbon dioxide + hydron
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB001823-beta-Hydroxy-4-beta-methyl-5-alpha-cholest-7-ene-4-alpha-carboxylateShow
YMDB001864-alpha-Methyl-5-alpha-cholest-7-en-3-oneShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB00607zymosterol intermediate 1cShow
YMDB00608zymosterol intermediate 2Show
YMDB006093-dehydro-4-methylzymosterolShow
YMDB006104beta-methylzymosterol-4alpha-carboxylic acidShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
YMDB161913-Keto-4-methylzymosterolShow
YMDB163174β-methyl-4α-carboxy-cholesta-8,24-dien-3β-olShow
YMDB163204α-carboxy-5α-cholesta-8,24-dien-3β-olShow
GO Classification
Component
Not Available
Function
catalytic activity
binding
oxidoreductase activity
steroid dehydrogenase activity
steroid dehydrogenase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
3-beta-hydroxy-delta5-steroid dehydrogenase activity
Process
steroid biosynthetic process
metabolic process
primary metabolic process
lipid metabolic process
steroid metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL001C
Gene Sequence>1050 bp ATGTCAAAGATAGATTCAGTTTTAATTATCGGTGGTTCTGGTTTTCTTGGATTGCACTTA ATTCAGCAATTTTTTGATATTAATCCTAAGCCAGACATCCACATTTTTGATGTTAGAGAT CTCCCTGAAAAACTTTCAAAACAGTTTACTTTTAATGTAGACGACATAAAATTTCATAAG GGTGATTTAACATCACCTGATGATATGGAAAACGCAATTAACGAAAGTAAAGCAAATGTT GTTGTTCATTGTGCTTCTCCAATGCATGGTCAAAATCCAGATATTTATGACATAGTGAAT GTTAAGGGAACCCGTAACGTGATAGATATGTGCAAGAAATGTGGCGTTAATATACTTGTA TATACTTCCTCTGCTGGTGTTATTTTTAATGGGCAAGATGTGCACAATGCAGACGAAACC TGGCCAATCCCAGAAGTTCCTATGGATGCGTACAATGAGACTAAAGCTATCGCCGAAGAT ATGGTCTTGAAGGCGAATGATCCAAGCAGTGATTTCTATACTGTTGCTCTTCGTCCAGCT GGTATTTTTGGCCCAGGTGATAGGCAATTAGTACCTGGTCTAAGACAGGTTGCGAAATTG GGGCAGTCGAAGTTCCAAATTGGTGATAATAACAATCTATTTGATTGGACTTATGCTGGA AATGTTGCTGACGCGCATGTGTTAGCTGCACAGAAACTTCTCGATCCAAAAACAAGAACT GCTGTCTCGGGTGAAACTTTTTTCATTACCAATGATACCCCCACCTATTTTTGGGCCTTG GCCCGTACTGTGTGGAAGGCAGATGGTCATATTGATAAACATGTTATTGTTTTGAAAAGG CCAGTTGCAATTTGTGCAGGTTATCTTTCAGAATGGGTATCCAAGATGCTGGGTAAAGAG CCAGGTTTGACTCCATTCAGAGTCAAGATTGTGTGTGCATACCGTTATCACAACATTGCT AAGGCCAAAAAGTTGCTAGGCTACACACCAAGAGTTGGTATTGAAGAAGGAATTAACAAA ACGTTGGCCTGGATGGACGAAGGTTTGTAA
Protein Properties
Pfam Domain Function
Protein Residues349
Protein Molecular Weight38706.10156
Protein Theoretical pI6.67
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating MSKIDSVLIIGGSGFLGLHLIQQFFDINPKPDIHIFDVRDLPEKLSKQFTFNVDDIKFHK GDLTSPDDMENAINESKANVVVHCASPMHGQNPDIYDIVNVKGTRNVIDMCKKCGVNILV YTSSAGVIFNGQDVHNADETWPIPEVPMDAYNETKAIAEDMVLKANDPSSDFYTVALRPA GIFGPGDRQLVPGLRQVAKLGQSKFQIGDNNNLFDWTYAGNVADAHVLAAQKLLDPKTRT AVSGETFFITNDTPTYFWALARTVWKADGHIDKHVIVLKRPVAICAGYLSEWVSKMLGKE PGLTPFRVKIVCAYRYHNIAKAKKLLGYTPRVGIEEGINKTLAWMDEGL
References
External Links
ResourceLink
Saccharomyces Genome Database ERG26
Uniprot IDP53199
Uniprot NameERG26_YEAST
GenBank Gene IDAY693026
Genebank Protein ID51013503
General Reference
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Gachotte, D., Barbuch, R., Gaylor, J., Nickel, E., Bard, M. (1998). "Characterization of the Saccharomyces cerevisiae ERG26 gene encoding the C-3 sterol dehydrogenase (C-4 decarboxylase) involved in sterol biosynthesis." Proc Natl Acad Sci U S A 95:13794-13799.9811880
  • Mo, C., Valachovic, M., Randall, S. K., Nickels, J. T., Bard, M. (2002). "Protein-protein interactions among C-4 demethylation enzymes involved in yeast sterol biosynthesis." Proc Natl Acad Sci U S A 99:9739-9744.12119386
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Mo, C., Bard, M. (2005). "Erg28p is a key protein in the yeast sterol biosynthetic enzyme complex." J Lipid Res 46:1991-1998.15995173
  • Natter, K., Leitner, P., Faschinger, A., Wolinski, H., McCraith, S., Fields, S., Kohlwein, S. D. (2005). "The spatial organization of lipid synthesis in the yeast Saccharomyces cerevisiae derived from large scale green fluorescent protein tagging and high resolution microscopy." Mol Cell Proteomics 4:662-672.15716577