You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAdenine phosphoribosyltransferase 1
Synonyms
  • APRT 1
Gene NameAPT1
Enzyme Class
Biological Properties
General FunctionInvolved in adenine phosphoribosyltransferase activity
Specific FunctionCatalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis
Cellular LocationCytoplasm. Nucleus
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Phosphoribosyl pyrophosphate + AdenineAdenosine monophosphate + Pyrophosphate
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00219PyrophosphateShow
YMDB00402Phosphoribosyl pyrophosphateShow
YMDB00887AdenineShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
transferase activity, transferring pentosyl groups
catalytic activity
transferase activity
transferase activity, transferring glycosyl groups
adenine phosphoribosyltransferase activity
Process
adenine salvage
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
cellular metabolic process
cellular aromatic compound metabolic process
nucleobase metabolic process
nucleoside metabolic process
purine base metabolic process
purine base biosynthetic process
metabolic process
purine base salvage
Gene Properties
Chromosome Locationchromosome 13
LocusYML022W
Gene Sequence>564 bp ATGTCTATAGCAAGTTATGCCCAAGAGTTGAAGTTGGCTTTACATCAATATCCAAACTTC CCTAGTGAAGGCATTCTCTTCGAAGATTTCTTACCCATTTTCAGGAACCCAGGTCTTTTC CAGAAGTTGATCGATGCTTTCAAACTGCATTTAGAAGAAGCTTTTCCAGAAGTTAAAATT GATTATATCGTCGGGTTGGAATCCCGTGGGTTCTTGTTCGGACCAACTTTAGCTTTGGCC CTAGGTGTTGGTTTCGTTCCAGTCAGGAAGGCAGGTAAGCTACCTGGCGAATGTTTTAAG GCTACGTACGAAAAGGAGTACGGTTCTGATCTTTTTGAGATACAGAAAAACGCTATTCCA GCAGGTTCCAACGTTATCATTGTTGATGACATTATTGCCACTGGTGGTTCTGCTGCTGCA GCCGGCGAATTAGTTGAACAACTCGAAGCCAACCTTTTGGAATATAACTTTGTTATGGAG TTGGATTTCTTGAAAGGCAGGAGTAAGTTGAATGCTCCAGTGTTCACTTTACTGAACGCT CAAAAGGAAGCGTTGAAAAAATGA
Protein Properties
Pfam Domain Function
Protein Residues187
Protein Molecular Weight20586.59961
Protein Theoretical pI4.75
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Adenine phosphoribosyltransferase 1 MSIASYAQELKLALHQYPNFPSEGILFEDFLPIFRNPGLFQKLIDAFKLHLEEAFPEVKI DYIVGLESRGFLFGPTLALALGVGFVPVRKAGKLPGECFKATYEKEYGSDLFEIQKNAIP AGSNVIIVDDIIATGGSAAAAGELVEQLEANLLEYNFVMELDFLKGRSKLNAPVFTLLNA QKEALKK
References
External Links
ResourceLink
Saccharomyces Genome Database APT1
Uniprot IDP49435
Uniprot NameAPT1_YEAST
GenBank Gene IDAY558232
Genebank Protein ID45270354
PDB ID
1G2P
General Reference
  • Alfonzo, J. D., Sahota, A., Deeley, M. C., Ranjekar, P., Taylor, M. W. (1995). "Cloning and characterization of the adenine phosphoribosyltransferase-encoding gene (APT1) from Saccharomyces cerevisiae." Gene 161:81-85.7642142
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Alfonzo, J. D., Sahota, A., Taylor, M. W. (1997). "Purification and characterization of adenine phosphoribosyltransferase from Saccharomyces cerevisiae." Biochim Biophys Acta 1341:173-182.9357956
  • Alfonzo, J. D., Crother, T. R., Guetsova, M. L., Daignan-Fornier, B., Taylor, M. W. (1999). "APT1, but not APT2, codes for a functional adenine phosphoribosyltransferase in Saccharomyces cerevisiae." J Bacteriol 181:347-352.9864350
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Shi, W., Tanaka, K. S., Crother, T. R., Taylor, M. W., Almo, S. C., Schramm, V. L. (2001). "Structural analysis of adenine phosphoribosyltransferase from Saccharomyces cerevisiae." Biochemistry 40:10800-10809.11535055